KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_82192Help
Entry
DICPUDRAFT_82192  CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K05289  GPI-anchor transamidase subunit GAA1
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
dpp00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
dpp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpp00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    DICPUDRAFT_82192
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gaa1
Motif
Other DBs
NCBI-GeneID: 10507702
NCBI-ProteinID: XP_003291526
JGI: Dicpu1_82192
UniProt: F0ZVT0
LinkDB All DBs
Position
Unknown
AA seq 653 aa AA seqDB search
MDSLIHEIEHQSTKLINLILPFLKNIKLITLLSILLQFVSIALVLLLPSFGSQTYVSEKN
LQCTVSPFISNNFAEKSINYSNIFSENFPNRSLGSNEALESANWIKNQLDTIGLDTQLHF
FNSSFDRVGVNVVGIVKATKSLGTECFVLTTSFDQWHSKGAVGFLIGFAEYMKNTTWQAR
DLIFLFTSEGGEMNGGTSMDISGSSVWIHDYFSSPPPIKNNFSRKTSRDKHQIGWIKDNK
VFKRGGKIYGAIALNRVGNQEMEKIIVYPEGLKGGLSNLDIINTVTTTTFLNEIPAGINS
HMVDEPVEGSIYGLLVFMWNSALSLPRSNHAIFTKYGINSVGISTDSSHNVWDIDFLNTP
LHKVHNFKNEYKQPLSNSTFLNLGKIMETVVRHLHNADEQLHQSYTWYVMAGAVFFIDIG
QALLPTIVLVVSMGVQFLSFILTVDNLPIRVISAMPEFFSTITFCFLLYLLPTILTYIGF
IPSNDLKLFVFIIYILILTPVSKYIKNIVISKYPILTYDWYGLQSLLLLHYSLVSLMCMM
LNNQFACLFMIFSLPTIQFTGFLMECSIRSKIIKFLWLLVCLFSHPVFLFFEWWSIWSVG
WKNLFSGVLIASNNWGFLFYPIFTLCLLPIFISIFKLLFITNCYNTKQKFKNF
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atggatagtttaatacatgaaattgaacatcagagcacaaaactaataaatttaatatta
ccttttttaaaaaatattaaattaataactcttttatcaattttattacaatttgtatcg
attgcattggtattattactacctagttttggttctcaaacttatgtttcagaaaagaat
ttgcaatgcacagttagtccgtttatatcaaataattttgcagaaaaatcaattaactat
tcaaatatattcagtgaaaattttccaaacagatctctaggatcaaatgaagctttagag
agtgcaaattggattaaaaatcaattagatactattggtttagatacacaactacatttt
tttaattcatcatttgatagggtaggagttaatgttgttgggattgttaaggcaactaaa
tcattaggtacagagtgttttgtgttaaccacatcatttgatcaatggcatagcaaagga
gcagtgggttttttaataggatttgcagagtatatgaaaaatacaacctggcaagcaaga
gatttaatatttttatttactagcgaaggtggtgaaatgaatggtggtacatcaatggat
atttcaggttcttcagtatggatacatgattatttttcatctccacccccaattaaaaat
aatttttcaagaaaaacatctagagataaacatcaaattggttggataaaagataataaa
gtttttaaaagaggaggaaaaatttatggagcaatagcattgaatagggttggtaaccaa
gaaatggaaaagattatagtatatccagaggggttaaaagggggactatcaaatttagat
attataaatacagttacaacaaccacattcctcaatgaaatacctgctggaattaattca
catatggtagatgaacctgttgagggttccatctatggtttgttagtgtttatgtggaac
tccgcattatcgttaccaagatcaaatcatgcaatttttacaaaatatggtataaactca
gttggtattagtactgattcctctcataacgtctgggatatagattttttaaatacacca
ttgcataaagtccacaattttaaaaacgaatataaacaacctttaagcaattcaactttt
ttaaatttaggtaaaattatggaaactgtggttcgtcacttacataatgctgacgaacaa
ctacatcaatcatatacatggtatgttatggcaggtgctgttttctttatagatatcggt
caagcactgttaccaacaatagttttagtagtttcaatgggtgtccagtttctttctttt
attttaacagtagacaatttaccaattagagttatatcagcaatgccagaattcttttca
acaataacattttgttttcttttatacttattaccaacaattttaacatatataggattt
ataccatcaaatgatttaaagctgtttgtttttattatatatatactcattttaacacca
gtttcaaaatatataaaaaatatagttatttcaaaatatccaatattaacttatgattgg
tatggtttacaatcattattattattacactattcattagtttctttaatgtgtatgatg
ttaaataatcaatttgcatgtttgttcatgattttttcattacctacgattcagtttaca
gggtttttaatggagtgttcaattagatccaaaatcattaaatttttatggctattggtg
tgcctattttctcacccagtatttttatttttcgagtggtggtcaatatggtctgtaggt
tggaagaatctatttagtggggttttaattgcttcaaataactggggtttcttattttac
ccaatatttacattatgcttattaccaatatttataagtatatttaaacttttatttata
acaaattgttataatactaaacaaaaatttaaaaatttttaa

DBGET integrated database retrieval system