KEGG   Desulfobulbus propionicus: Despr_3305Help
Entry
Despr_3305        CDS       T01413                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
dpr  Desulfobulbus propionicus
Pathway
dpr00970  Aminoacyl-tRNA biosynthesis
dpr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Despr_3305
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dpr03029]
    Despr_3305
Enzymes [BR:dpr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Despr_3305
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Despr_3305
Mitochondrial biogenesis [BR:dpr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Despr_3305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ADW19432
UniProt: E8RH72
LinkDB All DBs
Position
3802362..3803822
Genome map
AA seq 486 aa AA seqDB search
MELYALPLHEARRLLETGEVSSVALTESVLARIEAVEPKVQSYLTLDREGALRQAEQADI
ARKNGQGGPLCGIPLAIKDVLCTTTMPTTCGSRILENFVAPYEATVVTKLAEAGSVLVGK
LAMDEFAMGSTSENCAFKVPHNPWKLGYVAGGSSGGSAAAVAADECFASLGSDTGGSIRQ
PASLCGTVGMKPTYGRVSRYGLVAFASSLDQVGPLTKEVRDCALMMNAISGHDPKDSTSI
KLDVPDFTASLQDGLKGVKIGLPREYFVQGLDPEVDRAVRDGIRMLQEAGAELVEVTLPH
TDYCVAVYYLIAPAEASSNLARFDGVRYGYRDRSADSLIEMYNRTRSQGFGDEVKRRILI
GTYALSSGYYDAYYKKASQVRTLIKDDFAKAFAHCDLMVSPVCPTPAWKIGDKADDPLAL
YLSDILTLSANLAGVPGMSVPCGFSSDGLPIGLQLQAAHFNEEILLRAAYNLEQRAGVVG
KKPVIA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggaactgtacgcgttacccctgcacgaggcccggcgtctcctggagaccggcgaggtg
agttcggtggcccttaccgaatcggtgcttgcccggattgaagccgtcgaacccaaagtt
caatcctacctgaccctggatcgggaaggtgccctgcgacaggcagaacaggccgatatt
gccaggaaaaacgggcaaggcgggccgctgtgcggcatccccctggctatcaaggatgtg
ctctgcaccactaccatgcccaccacctgcggctcccgcatcttggaaaacttcgtcgcc
ccctacgaggccacggtggtgaccaaactggccgaggccggttcggtgctcgtgggcaag
ctggccatggacgaattcgccatgggctcgaccagcgaaaattgcgccttcaaagtaccc
cacaacccctggaagctcggctatgtggccggcggttccagcggcgggtcagcggcggcg
gtggcggccgacgagtgtttcgcctcgctgggttcagacaccggcggttcgatccgccag
cccgcctcgctgtgcggcacggtgggcatgaagccgacctatggccgggtgtcgcgctac
ggtctggtggcctttgcctcctcgctcgatcaggtcgggccgctgaccaaggaggtgcgc
gactgcgccctgatgatgaacgcgatcagcggccatgaccccaaggattccacctcgatc
aaattggacgtccctgattttaccgcctccctccaggacggactcaaaggggtgaagatc
ggtctacctagggaatatttcgtccagggactcgatcccgaggtggacagggcggtccgc
gacggcatccgcatgctccaggaggccggcgccgagctggtggaggtcaccctgccacac
accgactactgcgtggcggtctattatttgatcgccccggccgaggccagctccaacctg
gcccgcttcgacggcgttcgctacggctatcgcgaccgttcggccgactccctgatcgag
atgtacaaccgcacccgttcgcagggattcggcgacgaagtcaagcgccgtatcctcatc
ggcacctatgcactctcctcgggctattacgatgcctactacaagaaggcctcccaggtg
cgcaccctgatcaaggacgatttcgccaaggcctttgcccactgcgacctgatggtttcg
ccggtctgcccgaccccggcctggaagatcggcgacaaggccgacgatccgcttgccctc
tatctttccgatatccttactctgtcggccaaccttgccggcgtgcccggcatgtcggtg
ccctgcgggttcagcagcgacggcctgccgatcggtttgcagctccaggcggcccacttc
aacgaggaaattctgttgcgtgctgcctacaaccttgaacaacgtgccggcgttgtcggc
aagaaaccggtgatcgcctga

DBGET integrated database retrieval system