KEGG   Desulfotalea psychrophila: DP0316Help
Entry
DP0316            CDS       T00192                                 

Definition
(GenBank) probable superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
dps  Desulfotalea psychrophila
Brite
Enzymes [BR:dps01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     DP0316
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N DUF3427
Motif
Other DBs
NCBI-ProteinID: CAG35045
UniProt: Q6ARI0
LinkDB All DBs
Position
344106..344699
Genome map
AA seq 197 aa AA seqDB search
MSITLPELPYLKNALAPYISSETLDFHHGKHHSTYVTNLNKLIAGTELENATLEEIIKKT
VNDASKSGVFNNAAQIWNHTFYWQSMKAEGGGMPRGAIAEKIDADFGSYDNFVEQLKNAG
LTQFGSGWAWLVLNNNKLEIMKTANADTPIAHGLQALLTVDVWEHAYYLDYQNGRGTYLD
AFFNNLINWDFVNANLA
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcaccctacccgagcttccctacctaaaaaatgccctggcaccatatatcagc
tctgagacattggattttcatcatggcaaacaccacagtacctatgtcaccaacctgaat
aagctcatcgccggtactgaactggaaaatgcgacattggaagagatcataaaaaagaca
gtaaacgatgccagcaaaagcggagtcttcaacaatgccgcccagatttggaaccataca
ttttactggcaatcaatgaaggccgagggtggtggtatgccaaggggtgccattgccgaa
aagatcgatgccgacttcggtagctacgacaacttcgtagagcagctgaaaaatgccggt
cttactcagttcggcagcggttgggcctggttggtcctgaacaacaacaagctggaaatc
atgaaaaccgccaacgccgatacccccatagcccatggtttgcaagctcttctgaccgtg
gatgtctgggaacatgcctattatcttgactaccaaaacggccgaggcacctacctggat
gcctttttcaacaaccttatcaactgggattttgttaacgccaatctcgcctag

DBGET integrated database retrieval system