KEGG   Desulfotalea psychrophila: DP0385Help
Entry
DP0385            CDS       T00192                                 

Definition
(GenBank) probable glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
dps  Desulfotalea psychrophila
Pathway
dps00250  Alanine, aspartate and glutamate metabolism
dps00410  beta-Alanine metabolism
dps00430  Taurine and hypotaurine metabolism
dps00650  Butanoate metabolism
dps01100  Metabolic pathways
dps01110  Biosynthesis of secondary metabolites
dps01120  Microbial metabolism in diverse environments
dps02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:dps00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    DP0385
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DP0385
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DP0385
   00430 Taurine and hypotaurine metabolism
    DP0385
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    DP0385
Enzymes [BR:dps01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     DP0385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: CAG35114
UniProt: Q6ARB0
LinkDB All DBs
Position
415019..416443
Genome map
AA seq 474 aa AA seqDB search
MLRCYPRTEKEKRMPLHNKRKNNIMDDIYASSDLSIVLPKYKMPQKELDPRHAYQMVHDE
LMLDGNARQNLATFCQTWDDPEVHRLMDECIDKNMIDKDEYPQTAEIESRCVHILADLWN
APDSANSLGCSTTGSSEAAMLGGLALKKRWSEKRKAAGKGTDRPNIVCGPVQICWHKFAR
YWDVELREVPLEDQLYMTAEEAVKRCDENTIGVIPTLGVTFTCVYEPVEEICRALDQLQK
ETGLDIPVHVDGASGGFLAPFVDPDLKWDFRLKRVKSINASGHKFGLAPLGVGWVLWRDK
EELPEDLIFWVNYLGGNMPTFALNFSRPGGQIIAQYYNFLRLGHEGYRKIHQACYKTAQY
LSSEVKKLGPFEIIYDGRGGIPAMSFSLQEGVAPGFNLFDLSDRIRSRGWQIAAYSMPAN
REDLVVMRILVRHGFSRDLADLLLKDLQHCLEYFKKNPVIHQSSEEFSGSFKHS
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
ttgctcagatgctatccacgcacggaaaaggagaaaagaatgcccctgcacaacaagaga
aagaacaacatcatggatgatatctatgcatcatctgatctctccattgttcttcccaaa
tacaagatgccgcaaaaagagcttgatccccgccacgcctaccagatggttcacgacgaa
ctgatgctggatggcaatgcccggcaaaacctggcgaccttttgccagacatgggatgac
ccggaagttcacaggctgatggacgagtgtatcgataaaaacatgattgataaggatgag
tatcctcaaactgcagagattgaatcccgatgcgtgcacattctggccgatctctggaat
gccccggattctgccaacagcttgggttgctccaccaccggttccagtgaggcggccatg
ctcggtggactggccctaaaaaaacgctggagcgaaaagagaaaggccgccggcaagggc
acagacagacccaatattgtctgtggccctgtccagatatgttggcataaatttgcccgt
tactgggatgtggaactacgagaagtccccttagaggaccaactctatatgacggcggaa
gaggccgtaaagcgttgcgatgaaaacaccatcggagtcatacccaccctgggagttaca
tttacctgtgtctatgagccggtagaagagatttgcagggcccttgatcaactgcaaaaa
gagaccggcctcgacatcccagtccatgtggatggggcaagcggtggatttcttgctccc
tttgtcgatcccgatctcaaatgggactttcgcctgaaacgggtaaagtcgatcaatgcc
tcgggtcataaatttgggttggcaccactcggcgtaggctgggtgctctggcgagacaaa
gaggagctccccgaggacctcatcttctgggtcaactatctgggaggcaatatgcccacc
tttgccctcaacttctcccgcccaggaggacagattatcgcccagtactataacttccta
cgtcttggccatgagggctatcgcaaaatacaccaagcctgctacaaaacagcccaatac
ctctcaagcgaagtcaaaaaactcggcccatttgagatcatctacgatggcaggggaggc
attcccgccatgagcttctccttacaagagggcgttgccccgggattcaacctctttgac
ctatcggatcgcattaggagccgtggttggcagattgcggcctatagcatgcccgccaat
agagaggatttagtggtaatgcgcatcctcgtccgccatggtttcagccgggacttagct
gacctactcctcaaagaccttcagcactgcctggagtacttcaaaaaaaatccagttatt
caccagagcagtgaagagttctctggcagttttaagcacagctag

DBGET integrated database retrieval system