KEGG   Desulfotalea psychrophila: DP1542Help
Entry
DP1542            CDS       T00192                                 

Definition
(GenBank) conserved hypothetical membrane protein
  KO
K01992  ABC-2 type transport system permease protein
Organism
dps  Desulfotalea psychrophila
Brite
KEGG Orthology (KO) [BR:dps00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dps02000]
    DP1542
Transporters [BR:dps02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    DP1542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC2_membrane_3 ABC2_membrane ABC2_membrane_2 ABC2_membrane_4
Motif
Other DBs
NCBI-ProteinID: CAG36271
UniProt: Q6AN03
LinkDB All DBs
Position
complement(1721853..1722956)
Genome map
AA seq 367 aa AA seqDB search
MIETFFSHIFTLIGKEFTIILRDPKSRIIVILPPLIQFFIFGYAATFDLNQIPYAVLDES
HSPKSRQLLALFAGSENFHLVTSLSSNTEAREMLNRQEVRLIIHIPSEFDKTTAGSISAI
TDGRNSNVAAVSLGYVQSIIGVFNARQRGDSNIRQAPYIIGVAWFNENLQSRWFIVSALG
AVISMIVVMILSALSVAREREFGTFDQLLVAPFSSTEILIGKAIPCLVLGLFDALILSLG
AIMWFDIPFRGTFTALCLILLVFVLAIVGIGLFISAICSTMQQALLGAFIFIMPTVLLSG
FTTPIANMPDWLQTITYLTPLRYAVNGLRQIFLAGADSATVWPQIWPMILISSCTLPLAR
WMFNKRS
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgatagagacatttttttcacacattttcaccctgatcggcaaagaatttacaataatt
ctaagagatcccaaaagcagaattattgttattctgccccccctcatccaattttttatc
tttggctacgcggcaacatttgatctaaaccaaattccctatgcagtgctcgatgagtct
catagcccaaagtcacgacagttgcttgccctctttgcaggctctgaaaattttcacctt
gtcacaagccttagctcaaacactgaggcaagggagatgctcaatcgacaagaggtacga
ctcatcatccatatccctagcgaatttgacaagacaaccgctggcagcatctcggccatc
acggacgggcgtaactctaacgtggcagcggtcagccttggctatgtgcagtccatcata
ggggtctttaatgccagacaacggggggacagtaatattcgtcaggccccctatattata
ggggtggcgtggtttaatgaaaatctacagagcaggtggtttattgtttctgccctcggc
gctgtcatcagcatgatcgtggtcatgatcctctccgccctctccgttgcccgggaacgg
gaattcgggacctttgatcaactattggtcgcacccttctccagcacggaaatccttatc
ggcaaggctatcccctgccttgttttaggactttttgatgccctgatcctctccctgggg
gcaataatgtggtttgatattccctttcggggaacatttaccgccctttgcctaatcctg
ctggtctttgtcctggccattgtagggattggactctttatctcggcaatatgcagtacc
atgcaacaggccctgcttggtgcctttatatttattatgccaacggttctcctcagcggc
tttaccacccccattgccaatatgccagactggctccagactatcacctacctcacccca
ctgcgatacgccgtcaacggcttacgacaaattttcctggccggggcagatagcgccacc
gtctggccacagatctggccaatgatccttataagctcctgcaccctgccacttgccaga
tggatgttcaataaacgatcctaa

DBGET integrated database retrieval system