KEGG   Desulfotalea psychrophila: DP2814Help
Entry
DP2814            CDS       T00192                                 

Definition
(GenBank) related to penicillin-binding protein 4 [Precursor]
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
dps  Desulfotalea psychrophila
Pathway
dps00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:dps00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DP2814
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dps01002]
    DP2814
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dps01011]
    DP2814
Enzymes [BR:dps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     DP2814
   3.4.21  Serine endopeptidases
    3.4.21.-  
     DP2814
Peptidases and inhibitors [BR:dps01002]
 Serine peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   DP2814
Peptidoglycan biosynthesis and degradation proteins [BR:dps01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   DP2814
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: CAG37543
UniProt: Q6AJD7
LinkDB All DBs
Position
3172005..3173246
Genome map
AA seq 413 aa AA seqDB search
MIKCCLKKTPITRRLLLVLLAWVFLPTGWVSSSSLQEDIDHGGYWFTTTSKPLRLKETTG
FIPASTTKLVTALAGLRILGSDYRFSTDFLYDGKGALTIIGGGDPLLISEEIDKICRALK
LRGVSRVHTLRLETSLFHLPQPALGTEQTEQPYDAHNGALVVNFNSINVRVDETGIVLSA
EEQTPQLALMKDIVGLEAGKHRINVNQMVADDLPPVLRYSGELFLALLKRNGINTEDARI
ARGKAVEKSQLVLHWQSSCNLQETIGKCLKYSNNFIANQIFLQIGLHQYGAPATWEKGRR
ALNTFIQNDLRIEKSQLQLVEGSGLSRDNHISPRAMITVLENFAPYHSLLPYNSQTRTFI
KTGTLRGVYCLAGFQPRGEKLYPFVIFLNQIKNSRMSVLEDLIHLSRQKKEGA
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgattaaatgctgtctcaaaaaaacacccataacgaggaggctacttctcgtcctcctc
gcatgggtgtttttgccaacaggatgggtcagtagcagtagccttcaggaggatatcgac
catggaggctactggtttacaactaccagtaagccactcagactcaaggaaacgacaggt
tttattcccgcctccaccaccaagctggtcacggctctggcaggactgcgtatcctcggg
agcgactatcgtttcagcaccgattttttatatgacggaaagggggcgctcaccattata
ggcggtggcgatcccctcctgatttcagaagagatcgacaaaatttgccgggccttaaaa
ctccgaggcgtaagcagggtgcacaccctccgtcttgagacctcactcttccaccttccc
cagcccgcactcggcacagagcagacagaacaaccctacgacgcccacaatggagccctc
gttgtcaacttcaacagtattaatgtgagggtggatgaaactggcattgtcttatccgcc
gaagagcaaacaccacagttagcgctgatgaaagatatagtgggattggaagcgggcaag
caccgcatcaatgtcaaccagatggtagcagatgacctgccaccggttctgcgctacagt
ggggaactcttcctcgccctcctgaaaagaaacggcatcaatacagaagatgcacggata
gcgagagggaaagcagtagagaaaagccagctcgtactccactggcagtcaagctgcaac
ctccaagagacaattggtaaatgcttgaaatattctaataatttcattgccaaccagatt
tttttacagattggtctgcaccaatatggagcaccggccacctgggaaaagggcaggaga
gccctgaacacctttatccaaaatgatctgcgtatagagaagagccagttgcaactcgtt
gaaggctccggcctctcacgtgacaatcatataagccccagggcaatgatcacggttctt
gaaaatttcgctccatatcacagcttactcccctataatagccagacacggacattcatc
aagacgggtaccctccggggtgtttactgccttgctggatttcaacccaggggagaaaag
ctctatccatttgttatatttctcaatcagataaaaaattcacgaatgtccgtattggaa
gaccttatccatctttcccgacaaaaaaaagagggggcatag

DBGET integrated database retrieval system