KEGG   Deinococcus proteolyticus: Deipr_0097Help
Entry
Deipr_0097        CDS       T01426                                 

Definition
(GenBank) Malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
dpt  Deinococcus proteolyticus
Pathway
dpt00020  Citrate cycle (TCA cycle)
dpt00270  Cysteine and methionine metabolism
dpt00620  Pyruvate metabolism
dpt00630  Glyoxylate and dicarboxylate metabolism
dpt00680  Methane metabolism
dpt01100  Metabolic pathways
dpt01110  Biosynthesis of secondary metabolites
dpt01120  Microbial metabolism in diverse environments
dpt01130  Biosynthesis of antibiotics
dpt01200  Carbon metabolism
Module
dpt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dpt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dpt_M00012  Glyoxylate cycle
dpt_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:dpt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Deipr_0097
   00620 Pyruvate metabolism
    Deipr_0097
   00630 Glyoxylate and dicarboxylate metabolism
    Deipr_0097
  09102 Energy metabolism
   00680 Methane metabolism
    Deipr_0097
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Deipr_0097
Enzymes [BR:dpt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     Deipr_0097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C
Motif
Other DBs
NCBI-ProteinID: ADY25272
UniProt: F0RNN9
LinkDB All DBs
Position
complement(109672..110658)
Genome map
AA seq 328 aa AA seqDB search
MKEPVRVAVTGAAGQIGYSLLFRIAAGDMLGKDQPVILQLLEITPALKALEGVVMELRDG
AFPLLADVITSDDPEVAFKDADYALLVGAMPRKQGMERGDLLSANGGIFKPQGEALNKVA
SRNVKVLVVGNPANTNALIAQQNAPDLDPRCFTAMVRLDHNRAISQLAEKTGKPVTDIKN
VTIWGNHSSTQYPDLSQTTVGGEKALDLVDQNWYESEYIPTVAKRGAAIIEARGLSSAAS
AASAAIDHMRDWALGTKEGEWVSMGIPSDGSYGIPEGLIYGFPVTVKDGKYEIVQGLEVS
DFSRGKMDATAKELEEERDEVRKLGLVK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaacccgtacgtgtagcagtgaccggcgcggccggccagatcggttatagcctg
ctgttccgcatcgccgcaggcgacatgctgggcaaggaccagcccgtgattctgcagctg
ctggaaatcactccggccctgaaagcgcttgaaggcgtggtcatggaactgcgcgacggc
gccttcccgctgctggccgatgtcatcaccagcgacgaccccgaagtggccttcaaagac
gccgactacgccctgctggtaggcgccatgccccgcaaacagggcatggagcgcggcgac
ctgctgagcgccaacggcggcatcttcaagcctcagggcgaagccctcaacaaggtcgcc
agccgtaatgtcaaggttctggtcgtgggcaaccccgccaacaccaacgccctgatcgcc
cagcagaacgcccccgacctggacccccgctgctttaccgcgatggtgcgcctggaccac
aaccgcgccatctcgcagctggccgaaaagaccggcaagcccgtgaccgacatcaagaac
gtcaccatctggggcaaccactcctccacccagtacccggacctgtcgcagaccaccgtg
ggcggcgaaaaagcactcgacctggtggaccagaactggtacgagagcgagtacatcccc
accgttgccaagcgtggcgccgccatcattgaagcgcgtggcctgtcctccgccgcttcg
gctgccagcgccgccatcgaccacatgcgcgactgggccctgggcaccaaggaaggcgaa
tgggtcagcatgggcattccctccgacggctcctacggcattcccgagggcctgatttac
ggcttcccggtcacggtcaaggacggcaagtacgaaatcgtgcagggcctggaagtgagc
gacttcagccggggcaagatggacgccaccgccaaggagctggaagaagagcgcgacgaa
gtgcgcaagctcggcctggtcaagtaa

DBGET integrated database retrieval system