KEGG   Deinococcus proteolyticus: Deipr_0388Help
Entry
Deipr_0388        CDS       T01426                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
dpt  Deinococcus proteolyticus
Pathway
dpt00620  Pyruvate metabolism
dpt00680  Methane metabolism
dpt01100  Metabolic pathways
dpt01120  Microbial metabolism in diverse environments
dpt01200  Carbon metabolism
Module
dpt_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:dpt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Deipr_0388
  09102 Energy metabolism
   00680 Methane metabolism
    Deipr_0388
Enzymes [BR:dpt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Deipr_0388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DUF3412
Motif
Other DBs
NCBI-ProteinID: ADY25558
UniProt: F0RJT2
LinkDB All DBs
Position
411688..414216
Genome map
AA seq 842 aa AA seqDB search
MALNRDVSTLGRLLGQVLREQEGEAFFELVEKTRALVREVRAGGDSAELSGLLRGLSREE
ASNLARAFSWYFQLVNLAEEYERVRVLRERQGTRPQSLLQAVEELHRQGLSAAEAHELLA
TLQLELTFTAHPTEMRRRTVRQHLVDVVEQLPRLDEEEAQERVLAHIEALWGTPELRRIK
PTVADEVKAGLTYISSIARALPVLERDLDRAFAAVYGERGAAGISTQLPLRFSSWMGGDR
DGNPFVTPQATRAALELHRQRARDLLAAALRQAYADVSQEDLQAGEGQPTYRDELLALFQ
AVQRGEAADLSPRLGRVYRQLLEQGQRRTAEELLLPALTLARVFGQHLVSLDIREHSSQT
GRAVAELLQASGVTQDYLALDEDARLALLSAELRSRRPLWPAGEPLTETLETAIGPIREV
QAAAREVGPAAFGHYVVSMSESVSDVLEPLLLAREVGFRILPVPLFETLDDLEGAPDIVA
RLLALPEYRAHLGSDVQEIMLGYSDSNKDAGFLAANWALHEAQRRISAVCREAGVRWRFF
HGRGTSIGRGGGPASRAILGQPAGTIDAGLRITEQGEALADKYSHPVLARRNLEQALYGM
IVAAARPPQDPPAEWMDALDRAARAAAAAYRAFVQDPAFLPFFEQVTPIHEISRLNIASR
PVRRPGNPTLSNLRAIPWVMSWTQTRANLPGWYGLNIGLREIGTEQARQMYAEWPFFRAV
LDNAQMSLAKTDPAIFREYAALLAGADTPEAVEGGRALAGIIEEAYRDTVALVGEVVGGE
LLAREPRLAQSILLRNPYVDPIHRIQIELLRRARAEEGGLDRYEHALMLTLQGISAGVRN
TG
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atggcactgaaccgtgatgtgagtacgctgggccgcctgctgggccaggtcctgcgcgaa
caggaaggcgaagcctttttcgaactggtcgagaagacccgcgccctggtccgggaggtg
cgggccggcggcgactctgccgagctgagcggactgctgcgtggcctgagccgggaggag
gcgtccaacctagcccgtgcgttcagctggtactttcagctggtcaacctggccgaggaa
tatgagcgggtccgtgtgctgcgggagcgccagggcacccggcctcagagcctgcttcag
gccgtagaggaactgcaccgccagggcctgagcgctgccgaggcccatgagctgctcgcc
accctgcaactggaactcacctttaccgcgcaccccaccgagatgcgccgccgcacggtg
cgccagcatctggtggacgtggtggagcagttgccccgcctggacgaggaagaagcccag
gagcgcgtgctggcccatatcgaagcgctgtggggcacgccggagctacgccgcatcaag
cccaccgtggccgacgaggtcaaggcgggcctgacctacatctcgtctatcgcccgcgct
ctgccggtgctggagcgtgacctggaccgcgcctttgcggccgtgtacggcgaacgcggc
gccgccggcatctctacgcagctgccgctgcggttcagttcctggatgggcggcgaccgc
gacggcaaccccttcgtgacgccgcaggccacccgcgccgcgctggaactgcaccgccag
cgggcccgcgacctgctggcagcggcgctgcgccaggcctacgccgacgtgagccaggaa
gacctccaagccggcgagggtcagcccacctaccgtgacgaactgctggccctgtttcag
gcggtgcagcgcggtgaggcggccgacctctccccacgcctgggcagggtgtaccggcag
ttgctggaacagggccagcgccgcaccgctgaggaactgctgctcccagcgctgacgctg
gcccgcgtgttcgggcagcatctggtgagcctggatatccgggagcattccagccagacc
ggcagggcagtggcggaactgctgcaggcctccggggtgacgcaagattacctggcgctg
gacgaggacgcccggctggctctactgagtgccgaactgcgctcccgccgcccgctgtgg
ccggccggcgagccgctcacggagactcttgagacggccatcggacccatccgcgaggtg
caggcggccgcccgtgaagtcggcccggcggcattcggccattacgtggtttccatgtcc
gaaagtgtgagcgacgtgctggagccgctactgctggcccgcgaggtggggttccgcatc
ctgccggtcccgctttttgaaaccctggacgacctggagggtgccccggacatcgtggcc
cggctgctggccttgcccgagtaccgcgcccacctgggcagcgacgtgcaggaaatcatg
ctgggctactcggattccaacaaggacgccggctttctggccgccaactgggcgctgcac
gaggcccagcgccgtatcagcgcggtgtgccgtgaggcaggcgtgcgctggcgctttttc
cacgggcgcggcacttctatcgggcgtgggggcggtccagccagccgcgccattctgggc
cagccggccggcaccatcgacgcgggcctgcggatcaccgagcagggagaagccctggcc
gacaagtacagccatccggtgctggcgcgccgcaatctggagcaggcgctgtacggcatg
atcgtggccgctgcccgtccaccccaggacccgccagccgagtggatggacgcgctggac
cgcgccgcccgcgccgctgcggctgcctaccgcgccttcgtacaggacccggccttcttg
ccctttttcgagcaggtcacgccgattcacgaaatcagccgcctgaacatcgccagccgc
ccggtacgccggcccggcaaccccaccctgagcaacctgcgtgccattccctgggtgatg
agctggacgcagacccgcgccaacctgccggggtggtacggcctgaatatcggcctgcgc
gaaatcggaactgagcaggcccggcagatgtatgccgagtggccctttttccgcgctgtg
ctggacaacgcccagatgagcctggccaaaaccgacccagccatcttccgcgagtacgcc
gcgctgctggccggggccgatactcccgaagctgtggagggcggtcgggcgctggccggc
attattgaggaagcgtaccgcgacacggtagcgttggtgggtgaggtggtgggcggtgag
ctgctggcgcgggagccgcggctggcccagagcatcctgctgcgcaatccctacgtggac
cccatccaccgcatccagattgaattgctgcgccgcgcccgtgccgaggaaggtggcctg
gaccgctacgagcacgcgctgatgctgacgctacaggggatttcggccggggtgcgcaat
accggctga

DBGET integrated database retrieval system