KEGG   Deinococcus proteolyticus: Deipr_1106Help
Entry
Deipr_1106        CDS       T01426                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
dpt  Deinococcus proteolyticus
Pathway
dpt00564  Glycerophospholipid metabolism
dpt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dpt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Deipr_1106
Enzymes [BR:dpt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Deipr_1106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored NAD_binding_8 HI0933_like GIDA FAD_binding_3 Pyr_redox_2 Pyr_redox_3 Thi4 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ADY26258
UniProt: F0RNB6
LinkDB All DBs
Position
1165297..1166865
Genome map
AA seq 522 aa AA seqDB search
MTQHTSDPRTAQLQAATQSREWDFIVVGGGASGLGTAVEAATRGYSVLLLEGHDYAKGTS
SRSTKLVHGGVRYLAQGNVSLVREALHERGLLRKNAPHLVHDLEFVVPGYTWWSAPFYGI
GLKMYDLLAGKLNLGSSRYLDKQAALHRIPTLQNEGLTGGILYFDGQFDDARLAITLLRT
LEDFGGVALNHAPVTGLIKDGGQVRGVRFRDEETGQEHAARARVVVNATGVWVDDVRKME
DPSIKPMLSPSQGVHVVVDRKFLPGNSAIMIPRTDDGRVLFAVPWHDHVVIGTTDTAVPD
TSFEPRPLPEEIDFILRTAGRYMSPAPTRDDVKSVYVGLRPLVKPADASDTKAISRDHTV
VISDGGLVTLTGGKWTTYRRMGEDTVNKAEKVAGLPGRVSTTQALHLHGWSDEEQPDHWK
VYGTDAWRIQELPGADQPLHPALPYTEAEVRWAARFESARTVEDVLARRLRAQLLDARAS
MEAAPRVAALLAEELGQDEAWQRQQVQEYREVTQGYLLPTQS
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgacccagcacacttctgacccccgcaccgcccagctgcaggccgcaacccagagccgc
gagtgggactttatcgtggtgggcggcggcgcttcgggcctgggcacggccgtggaagcc
gccacccgaggctactcggtgctgctgctagaaggccacgactacgccaaaggcacgtcc
agccgctctaccaagctggtccacggcggcgtgcgctacctggcccagggcaacgtgagc
ctggtgcgcgaggccctgcacgagcgcgggctgctgcgcaaaaatgccccgcacctggtc
cacgacctggaattcgtggtgcccggctacacctggtggtcggcgcccttttacggcatc
gggttgaagatgtacgacctgctggccggcaaactgaacctgggcagctcgcgctatctg
gacaagcaagcagcgctgcaccgcattcccaccctgcaaaatgagggcctgaccggcggc
atcctgtacttcgacgggcagttcgacgacgcccggctggcgattacgctgctgcgcacg
ctggaagacttcggcggcgtggccctgaaccacgcgcccgtgaccggactgatcaaggac
ggaggccaggtgcgcggcgtgcgcttccgcgacgaggaaaccggccaggagcatgcagcc
cgtgccagggtcgtggtcaacgccaccggcgtatgggtggacgatgtccgcaagatggaa
gaccccagcatcaagcccatgctttcgcccagtcagggcgtgcatgtggtggtggaccgg
aagttcctccccggcaacagcgccatcatgattccccgcaccgacgatgggcgggtcctg
ttcgccgtgccctggcacgaccacgtggtgattggcaccaccgacacagccgtgcccgac
acgtcctttgagccgcgcccgctgcccgaggaaatcgactttatcctgcggaccgccggc
cgctacatgagtccagcccccacccgtgacgacgtgaaaagcgtatacgtgggcctgcgc
ccgctggtgaaacctgccgacgccagcgataccaaagccatcagccgtgaccacaccgtg
gtgatttcggacggcggcctggtcacgctgaccggcggcaaatggaccacctaccgccgc
atgggcgaggacaccgtgaacaaggccgaaaaggtggcgggactgccgggccgtgtcagc
accacccaggccctgcacctgcacggctggagcgacgaggagcagccggaccactggaag
gtgtatggcaccgacgcgtggcgcatccaggagctgcccggcgcggaccagcccctgcac
ccggccctgccctacaccgaagccgaagtgcgctgggccgcccgctttgaaagcgcccgc
accgtggaagacgtgctggcccgccgcctgcgtgcccagctgctggacgcccgcgccagc
atggaagccgctccccgcgtggccgcgctgctggccgaggaactgggccaggacgaagcc
tggcagcgccagcaagtgcaggaataccgcgaggtgacccagggttacctgctccccacc
cagagctga

DBGET integrated database retrieval system