KEGG   Deinococcus proteolyticus: Deipr_1302Help
Entry
Deipr_1302        CDS       T01426                                 

Definition
(GenBank) 33 kDa chaperonin
  KO
K04083  molecular chaperone Hsp33
Organism
dpt  Deinococcus proteolyticus
Brite
KEGG Orthology (KO) [BR:dpt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:dpt03110]
    Deipr_1302
Chaperones and folding catalysts [BR:dpt03110]
 Heat shock proteins
  HSP33
   Deipr_1302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33 SnoaL_3
Motif
Other DBs
NCBI-ProteinID: ADY26451
UniProt: F0RPA8
LinkDB All DBs
Position
1377050..1377994
Genome map
AA seq 314 aa AA seqDB search
MTDSAYTQSYLLRGIAAQGTLRVVAMDGTQIVEEARLRHNLSKTATAALGRSLIGAGLLA
VVLGKNAGSRVALRIQGGGPIGWVVAEGTAGGEVGGTYQPGSVRGYVHEPGADLPPRESD
GKLDVSGVVGKEGELAVTRLLDNAEPWTGSVELVSGEIAEDISTYLGRSEQIPNALLLGV
YEEGGRVAVSGGLLIQAMPGVSDETLSRLEQNIAGIGLLTTSMREVGLLGTVQRALEGLE
PQISEDAEPWAFKCRCSRERAASSLMFFDEAERQDMQNEGGQEVVCHWCNEKYFFQPEEI
AGLELEAGENPAQA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaccgattctgcctatacccagtcctacttgctgcgcggaattgcagcgcagggaacc
ttacgggtggtcgccatggacggcacccaaatcgtggaagaagcgcggctgcgccataac
ctcagcaagaccgccacggccgcactgggccgcagcctgatcggcgccgggctgctggcc
gtcgtgctgggcaagaacgccggcagccgggtggccctgcggattcagggcggcggccct
atcggctgggtggtggccgaaggcactgccggcggcgaagttggcggcacctaccagcct
ggcagcgtgcggggctacgtgcacgagcccggcgccgacctgcccccccgcgagagcgac
ggcaagctggacgtaagcggcgtggtaggcaaagagggcgaactggccgtgacccgcctg
ctggacaatgccgaaccctggaccggcagcgtggagctggtcagcggcgagattgccgag
gacatcagcacctatctgggccgcagcgaacagattcccaacgccctgctgctgggcgtg
tacgaagaaggcggccgggtggcagtcagcggcggcctgctgattcaggccatgcccggc
gtgagcgacgagaccctgtcccgcctggaacagaacattgccggcatcggcctgctgacc
acttccatgcgcgaagtgggcctgctgggcaccgtgcagcgtgcgctggaaggcctggaa
ccccagatcagcgaggacgccgagccatgggccttcaaatgccgctgctcgcgcgagcgg
gccgccagcagcctgatgttcttcgacgaggccgagcgtcaggacatgcagaacgagggc
ggccaggaagtggtttgccactggtgcaacgaaaaatacttcttccagcccgaggaaatc
gcggggctggaactggaagccggcgagaacccggctcaggcctga

DBGET integrated database retrieval system