KEGG   Deinococcus proteolyticus: Deipr_1328Help
Entry
Deipr_1328        CDS       T01426                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
dpt  Deinococcus proteolyticus
Pathway
dpt00473  D-Alanine metabolism
dpt00550  Peptidoglycan biosynthesis
dpt01100  Metabolic pathways
dpt01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:dpt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Deipr_1328
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Deipr_1328
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Deipr_1328
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dpt01011]
    Deipr_1328
Enzymes [BR:dpt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Deipr_1328
Peptidoglycan biosynthesis and degradation proteins [BR:dpt01011]
 Precursor biosynthesis
  Amino acid ligase
   Deipr_1328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ADY26477
UniProt: F0RPD4
LinkDB All DBs
Position
complement(1411648..1412730)
Genome map
AA seq 360 aa AA seqDB search
MSDLTPAQPQSPSESPSAPRQPRRRVLLLAGGQSEEHEVSLSSARSVLAALPQDRFEVTA
VVISKQGRWLPPAETAQALGAGAAESGGEPMLQRVSDTAGYDVVFPLLHGPMGEDGTVQG
LLTLAGLPFVGSGVLGSSVGMDKIMTKRVLEAAGIPQVAWREASRAEWRRDPQGVQSRAA
ELGFPLFVKPANMGSSVGVSRVTGAGELAEALELAFGHDRRVIVEAAAGAKPREVEVGIL
GNDDPVASPVGELRFDTDFYDYDTKYTGGRAEMLIPAPLPEGVSERIQELALRAYQALDC
AGLSRVDFFYVEETGELLLNEINTMPGFTTTSMYPSLLQAHGLSYPELVTRLIELALEER
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacctgacccctgcccagccccagtctccgtccgaatccccgtccgcccccagg
cagccgcgccgccgcgtgctgctgctggccggcggccagtccgaggagcacgaggtcagc
ctctccagcgcccgctcggtgctggccgcgctgccgcaggaccgctttgaagtgaccgcc
gtagtgatttccaagcagggccgctggctgcccccggccgaaacggcgcaggctttgggc
gcgggcgccgccgagtcgggcggcgaacccatgctgcagcgggtgtcagatactgccggc
tacgatgtggtgtttccactgctgcacggcccgatgggcgaggacggcaccgtgcagggc
ctgctgaccctggcaggtctgccgttcgtgggcagcggcgtgctgggcagcagcgtgggc
atggacaaaatcatgaccaagcgggtgctggaagcggccggtattccccaggtggcctgg
cgtgaggccagccgcgccgagtggcgccgtgacccgcaaggtgtgcagagccgcgccgcc
gaactgggcttcccgctgttcgtgaagccggccaacatgggcagcagcgtgggcgtgagc
cgggtgacgggcgctggcgagctggcggaggccctggaactggccttcgggcacgaccgc
cgggtaatcgtggaagcggcggctggcgccaagccccgcgaggtggaggtgggcattctg
ggcaacgacgacccggtggccagcccagtaggcgaactgcgtttcgacaccgatttttac
gactacgacaccaagtacaccgggggccgcgccgagatgctgattcctgcgccgctgcct
gagggggtgtccgagcggattcaggagctggcgctgcgggcttatcaggccctggactgc
gccggcctgagccgggtggatttcttttacgtggaggaaaccggcgagctgctgctcaac
gaaatcaataccatgccgggctttacgaccacttccatgtatccctcactgctgcaggcg
cacggcctgagctacccggaactggtgacccggctgattgagctggcgctggaagaacgc
tag

DBGET integrated database retrieval system