KEGG   Deinococcus proteolyticus: Deipr_1860Help
Entry
Deipr_1860        CDS       T01426                                 

Definition
(GenBank) hypothetical protein
Organism
dpt  Deinococcus proteolyticus
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADY26992
UniProt: F0RLY2
LinkDB All DBs
Position
1977937..1980069
Genome map
AA seq 710 aa AA seqDB search
MNPVLSRIPVKMLGDVLSTRALERIIQDAAQERRVHPAQLDAQALESVLKKDIYRRLQLS
LPAKLAKKRVLDVLGEVQRVAAEVGTVDYVPADLSGLEEGVRRFTLYFDWPESQRLRGVL
NMARQEESVGNDVSALLQEGESLIEQMDRRLAEGLVAQGQDLAELRATFERVSAVGGREV
RRLETLLEQVDDAQKQGMLLPGEVERARTLSLKLRRQLESSVVQNTPGDAQPDPAAEAKL
RALELELVGRRLGDVLAEFSPLIGARPELEAHAAALNDALAGGTLTEQAVADWQQDLSAR
RGQLRSEQQAQLAELERQLAELPASGEAEKARVTLGLARHTLEEGGLAADELRDLALAVQ
ALQSSPGGASETLRQQRELSELERSARDVSGAGEELAPQIAQARERLQRGEDVDIDALYA
VLERRMGQAAQEREGLDARADHVVREYDSVRDLAGETIQKLGRLADTLRAQRRLGQLSVQ
ARERYLQTLTEAEALLDEARAEHAAAQEVTASFGEDALSGLLDIFDLESAESGLFDVDAS
EPEPGSDLLVGGKNEDEDLRPGTGTGSGDSAGAAGSPGTAAGADTGGFNPFAFLSGTSAA
ASHPADSLPAAASAEPGDAAPPPLTEAQHLPEHAWLIAHGRRQAGQPDHAAERLAPLLQS
AAELGITRLRFEDGDWSWSARQSPAGTWRLARAADAATLELNSGAWLKQD
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgaatccagttctgtcccgaattccggtcaagatgcttggggacgtgctgtccacgcgc
gccctggagcgcattattcaggacgccgcccaggagcggcgcgtccacccggcgcagctg
gacgcccaggcgctggaaagcgtgctgaaaaaggacatctaccgccgcctgcagctgagc
ctgccggccaagcttgccaaaaagcgtgtgctggacgtgctgggcgaggttcagcgggtg
gccgccgaagtaggcactgtggactacgtgccggcggacctcagcgggctggaagaggga
gtgcggcgcttcacgctgtatttcgactggcccgagtcgcagcggctgcgcggcgtgctg
aacatggcccgccaggaagaatcggtgggcaacgacgtgtcggccctgctgcaagagggc
gaaagcctgattgagcagatggaccgccgcctggccgaggggctggtggcgcaggggcag
gacctggccgagctgcgggccaccttcgagcgggtcagcgccgtgggcgggcgcgaggtg
cgccgactggaaaccctgctggagcaggtggacgacgcccagaaacagggcatgctgctg
cccggcgaggtggagcgggcccgcaccctcagcctgaaactgcgccggcagctagaatcc
tcggtggtgcaaaacactcccggcgacgcacagcctgaccccgccgccgaggccaagctg
cgtgcgctggagctagagcttgtaggccgccgtctgggcgacgtgctggctgaattcagc
ccgctgattggggcacggcccgagctggaagcgcacgccgccgccctgaacgacgccctg
gccggcggtacccttaccgagcaggccgtggccgactggcagcaggacctgagcgcccgg
cgcggccagctgcgcagcgaacagcaggcgcagctggccgaactggaacgccagctggcg
gagctgccggccagcggcgaagccgagaaggcccgcgtcaccctgggcctggcccgccat
accctggaagaaggtggcctggccgccgatgagctgcgcgacctggccctggccgtgcag
gcgctgcaaagctcgccgggcggcgccagcgaaaccctgcgccagcagcgcgaactgtcc
gagctggagcgcagtgcccgtgacgtgagcggcgccggtgaggagctggccccccagatt
gcccaggcccgtgagcgcctgcagcgcggcgaagacgtggacattgacgccctgtacgcc
gtgctggaacgccgcatgggccaggccgctcaggaacgtgaggggctcgacgcccgcgcc
gaccacgtggtgcgcgagtacgactcggtgcgcgacctggccggcgagaccatccagaag
ctggggcgcctggccgataccctgcgggcccagcgccgactggggcagctgtccgtccag
gcccgcgagcgctacctgcagaccctgaccgaagccgaagccctgctggacgaagcccgc
gccgaacacgcagccgcgcaggaagtgaccgccagcttcggtgaggacgcgctgagtggc
ctgctggacatcttcgacctggaaagcgcggagagcgggctgttcgacgtggacgccagc
gaacccgagcccggcagcgacctgctggtaggcggcaagaacgaagacgaagacctccgc
cctggcaccggcaccggcagcggcgactctgcgggggcggcaggttccccgggcaccgct
gccggcgcggacacaggcggtttcaatcctttcgcctttctgtctggcacgtcggcagca
gcctcccacccggcagacagcctgccggcagcggccagcgcggagcctggagacgccgcg
cccccgccactgaccgaggcgcagcatctgccggagcacgcctggctgatagcccacggc
cgccggcaggctgggcagccggaccacgccgccgagcgcctcgccccgctgctccagagc
gcggccgagctgggcatcacgcgcctgcgctttgaggacggcgactggagctggagtgcc
cgccagagcccggccggcacctggcgtttggcgcgcgccgccgacgccgccactctggaa
ctgaacagcggcgcctggctgaaacaggactga

DBGET integrated database retrieval system