KEGG   Dermatophagoides pteronyssinus (European house dust mite): 113790791Help
Entry
113790791         CDS       T05775                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn] 2-like
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
dpte  Dermatophagoides pteronyssinus (European house dust mite)
Pathway
dpte04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:dpte00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    113790791
Enzymes [BR:dpte01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     113790791
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu SPAN
Motif
Other DBs
NCBI-GeneID: 113790791
NCBI-ProteinID: XP_027196298
LinkDB All DBs
Position
Unknown
AA seq 152 aa AA seqDB search
MVKAVVVLKGDPNVSGTIFFEQQDNGPVKVTGSVQGLKPGLHGFHVHEFGDNTNGCTSAG
AHYNPLNKTHGAPSDEERHVGDLGNIEANDKGVANVVIEDSLISLTGEKSIVGRSLVVHA
DPDDLGRGGHELSKTTGNAGGRLVCGVIGVTK
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggttaaagcagttgttgtattgaaaggtgatccaaatgtcagtggtacaatttttttc
gaacaacaggataatggtccggtaaaagttactggtagtgttcaaggattaaaacccggt
ctacatggatttcatgttcatgaatttggtgacaatacaaatggttgtacatcggctggt
gctcattataatccattgaataaaacacatggtgcacctagtgatgaagaacgtcatgtt
ggtgatttaggcaatattgaagccaatgataaaggtgttgctaatgttgtaattgaagat
tcattaatcagtttgactggtgaaaaatcaattgttggacgttcattggttgtacatgct
gatccagatgatcttggacgtggtggacatgaattaagcaaaacaaccggtaatgcaggt
ggacgtcttgtttgtggtgttattggcgttacaaaataa

DBGET integrated database retrieval system