KEGG   Dermatophagoides pteronyssinus (European house dust mite): 113791554Help
Entry
113791554         CDS       T05775                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
dpte  Dermatophagoides pteronyssinus (European house dust mite)
Pathway
dpte00020  Citrate cycle (TCA cycle)
dpte00190  Oxidative phosphorylation
dpte01100  Metabolic pathways
dpte01200  Carbon metabolism
Module
dpte_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dpte_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dpte_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:dpte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    113791554
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    113791554
Enzymes [BR:dpte01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     113791554
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 DAO GIDA FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-GeneID: 113791554
NCBI-ProteinID: XP_027197149
LinkDB All DBs
Position
Unknown
AA seq 672 aa AA seqDB search
MINLINAKMSMRLLHKCIRLRSNCCDVRGTSRTNNSAMDMVEKIFHRNISTTSRCNDKSN
LKSYQVIDHTFDAVVVGAGGAGLRAAFGLVEKGFNTAVVSKLFPTRSHTVAAQGGINAAL
GNMEPDDWRWHMYDTVKGSDWLGDQDAIQYMTREAPKAVTELENYGMPFSRTPEGKIYQR
AFGGQSYNFGKGGQAHRCCAVADRTGHSLLHTLYGQSLRYDCKYFIEYFVLDLIMEGGAC
RGVIALSLEDGTLHRFKSKNTILATGGYGRAFFSCTSAHTCTGDGTAMVNRAGLPSQDLE
FIQFHPTGIYGAGCLITEGCRGEGGFLVNSEGERFMERYAPVAKDLASRDVVSRSMTIEI
REGRGCGPQKDHVYLQLHHLPAEQLALRLPGISETAMIFAGVDVTREPIPVLPTVHYNMG
GIPTNYKGQVLTYSKEKGDTVVPGLYAAGEAGCASVHGANRLGANSLLDLVVFGRACAHA
IAESDRPGEPLPEFSATAGEASVANLDRLRYAKGSILTAQLRLKMQRDMQEHAAVFRTGP
LLKEGVEKLKQDYKMLDDLKVMDSGLIWNSDLVETLELQNLMLNAMMTVNSAEARKESRG
AHAREDYKDRIDEFDYSKPLDGQKRRSFEEHWRKHTLSYVQPDGTVKLWYRPVIDKTLDE
QAQTIPPAVRSY
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgataaatttgatcaatgcaaaaatgtcgatgcgcttattacacaaatgtataaggcta
aggtcgaattgttgtgatgtgcgtgggacatcgaggacaaataattctgccatggacatg
gtagaaaaaatctttcatcgcaatatctcgaccacttcccgatgcaatgataaatcaaat
cttaaaagctatcaggtgattgatcatacatttgatgccgtagttgttggtgcaggtggt
gccggtcttcgtgctgcatttggtcttgtagaaaaaggatttaatactgctgttgttagt
aaattatttcctacccgatcacatacggttgctgcacaaggtggtattaatgctgcgttg
ggcaatatggagccagatgattggcgttggcatatgtatgatacggttaaaggttccgat
tggctcggtgatcaagatgccattcaatacatgacacgagaagcacccaaagcggtcact
gagctcgaaaattatggaatgccttttagccgtacaccggaaggcaaaatctatcaacga
gcattcggtggtcaatcttataattttggtaaaggtggtcaagcacatcgttgctgtgcc
gtagccgatcgtaccggtcattcactattacatactttatatgggcaatcattgcgttat
gattgcaaatatttcatcgaatattttgttctcgatttgattatggaaggtggtgcttgt
cgtggtgttatagcattatcactagaagatggcactttgcatcgattcaagtcgaagaat
acaatcctagctacggggggatatggtcgtgcctttttttcctgtacatctgcacataca
tgcacgggagatggtacggccatggtcaaccgtgctggtcttccttctcaggatcttgaa
tttattcaattccatcctacgggtatctatggtgccggttgtttaataactgaaggatgt
cgtggcgaaggtggatttctggtcaacagtgaaggagaacgcttcatggaacgatatgca
ccagtagcaaaagatttagcatcgagggatgtcgtctcacgatcaatgaccattgaaatt
cgagaaggacgtggttgtggtcctcaaaaagatcatgtctatctacagttgcatcattta
ccagccgaacaattggctcttcgtttgcctggcatttcagagactgccatgatctttgcc
ggtgttgatgttactcgagaaccaataccagtactgcccactgttcattataatatgggt
ggtataccgaccaattataaaggacaagtgttgacttactcaaaggaaaaaggtgataca
gttgttccaggtctatatgcggcgggtgaagcaggttgtgcatccgtacatggagccaat
cgtttaggtgcgaattcccttttggatttggtggtttttggtcgtgcttgtgctcatgca
attgctgaatctgatcgtcctggtgaaccattacctgaattttctgctacagctggtgaa
gcttccgttgctaatctggatcgtttacgttatgccaaaggttctatattgacagctcaa
ttacgattgaaaatgcaaagagatatgcaagaacatgcagcagttttccgtacaggtcca
ttattgaaagaaggtgttgaaaaactcaaacaagactataaaatgcttgatgatttgaag
gtaatggactccggattaatatggaattcagatcttgttgagacattggaattacaaaat
ttaatgctcaatgcaatgatgaccgtaaattctgctgaagcacgaaaagaatcacgaggt
gcacatgcacgagaagattataaagatcgtattgatgaatttgattattcgaaaccattg
gatggtcaaaaacgacgctcatttgaagaacattggcgtaaacatactttatcgtatgta
caacctgatggtactgttaaactttggtatcgtcctgtaattgataaaacattggatgaa
caagcacaaacaataccgccagctgtacgatcatattag

DBGET integrated database retrieval system