KEGG   Dermatophagoides pteronyssinus (European house dust mite): 113791730
Entry
113791730         CDS       T05775                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: adenylate cyclase type 3-like
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
dpte  Dermatophagoides pteronyssinus (European house dust mite)
Pathway
dpte00230  Purine metabolism
dpte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpte00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    113791730
Enzymes [BR:dpte01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     113791730
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 HNOBA
Other DBs
NCBI-GeneID: 113791730
NCBI-ProteinID: XP_027197348
LinkDB
Position
Unknown
AA seq 1186 aa
MGNDDDDVINEMANNDKLFTNPDESKHLKPNNGDHSKNPVYGTAITLVTKTPTPTTTTTT
TTIIGNGKQNIEINDNNTMMIPISDSSGLANGSRNGGQTTATTTNNDDNFVDEELLNLNE
TTNHLKRHSLTLKRGDTELSIDHGGMQRFLPTFMHFAFADREAEQLYQEYYSNEKRNDFK
ALIVIVIFVNIVLLGLHFLSSSWNQSDLSHQQLIILFSCLILAIFLFILCLRRSRDQLAS
RLWSLIPFALWIVMLVQIICDLCIFIGRPPEPSGSLCWLLLYSYATYVIFPLRFRICCIL
SILMAILHSLLIFMFTTSTYKFTNQIFANLIIIVSVNLLSTMSFFFYERQQRRAFLETRQ
SLETKLTLEEQSQEQERLLLSVLPKHVAAEIRQDLGAVVGGQFHKIYMSRHENVSILFAD
IVGFTAISSTCSAPELVKTLNELFARFDKLSDKYHQLRIKILGDCYYCISGAPEERPDHA
VLCVHMGLSMVEAIKSVREQTKSTVDMRVGIHTGSVLAGVLGQRQWQFDVYSRDVELANK
MESAGLPGRVHISEKTLNFLDGEFEIIDGDGASREEVVRLSGIKTYFITKIIKPYPEGTL
DAMIQMDIPNADDCGETTKLKNDINVDRFRQEDIKDPEIYKQRLHAELIHRESEKNIAEH
TDLFSLTFKNSDIEQEYRESRDITSCISLLGLPFTLFIYLLSFVLIGPFCLQIYLTLVIC
LLLLIVKAFICTISIIWTSIPKPLAILSNAVQQKSWIRVTIAGSMIALWITAHIVANIFY
DDNLENEYANLIISGSTDRYHIADHVIALPQYLIFFCILGLLAITVLTRIQFLMKATIII
CLAFIQCFLIYFSLTYAFKVYKLINYQQFIHSRHNYVIIIITIVIGLIIINRQFELMTRR
LFLWQKDIDQQKEMVADMRRKNEALVYNILPPHVAVHFLGKRKNDEELYSKSYECVGVLF
ASMPNFADFYTEESVNNQGLECLRFLNEVISDYDSLLSQQRFKDIFKIKTISSTYMAASG
LNIDETNDCSKSNNIIEKWSHLAQLTEFALTMKETLNGINKESFNNFVLRIGINQGPITA
GVIGARKPHYDIWGNTVNVASRMESTGKAGCIQVVQETMEILKEFNFIFEQRGLVSVKGK
GKLMTYYLIGKKKXKLKNLFTKKKLLITRSSLINFDFENLKNKPIS
NT seq 3561 nt   +upstreamnt  +downstreamnt
atgggaaatgatgatgatgatgttatcaatgaaatggccaataatgataaattatttact
aatccggatgaatcaaaacatttaaaaccaaataatggtgatcattcaaaaaatccagtt
tatggtacagcaataacattagtaacaaaaacacctacaccaacaacaacaacaacaaca
acaactataatcggtaatggaaaacaaaatattgaaatcaatgataataatacaatgatg
ataccaatatcggattcttctggcctagccaatggtagtagaaatggtggtcaaacaaca
gcgactactacgaataatgatgataattttgttgatgaagaattattaaatttaaatgaa
acaacaaatcatttaaaaagacattcattaacattaaaacgtggtgatactgaattaagt
attgatcatggtggtatgcaaagatttttaccaacatttatgcattttgcatttgctgat
cgtgaagccgaacaattatatcaagaatattattcaaatgaaaaacgtaatgattttaaa
gcattaattgttattgtgatatttgtaaacattgttttattgggccttcattttttgtca
tcatcttggaatcaaagtgatctttctcatcaacaattaattatattatttagttgtctt
atattggcaatatttttatttatattatgtttacgacgatcacgtgatcaattagcatca
cgtctttggtcattaataccatttgcattatggattgtaatgttagtacaaataatctgt
gatctttgtatatttattggtaggccacctgaaccatctggttcattatgttggttattg
ctttattcatatgctacttatgttatatttccattacgttttcgtatttgttgtatatta
agcattcttatggcaatattacattcattattaatttttatgtttacaacatctacttat
aaatttactaatcagatattcgccaatctgattattattgtcagtgtaaatttattaagt
acaatgtcattctttttctatgaaagacaacaaagacgtgcatttcttgaaacaagacaa
agtttggaaacaaaattaacattagaagaacaatcacaagaacaggaacgattattatta
tcggtattaccgaaacatgttgcagccgaaataagacaagatttaggtgctgttgttggt
ggacaatttcataaaatctatatgagtcgtcatgaaaatgttagcatattatttgctgac
attgttggttttactgccatatcatctacatgttcagcaccagaattagttaaaacatta
aatgaattatttgcacgttttgataaactatcggataaatatcatcaattacgtataaaa
atattgggtgattgttattattgtataagtggtgcacctgaagaacgacctgatcatgct
gtactttgtgttcatatgggtctttcaatggttgaagcaatcaaatctgttcgtgaacaa
acaaaatcaacggtcgacatgagagttggaatacatacgggtagcgttttggctggtgta
cttggtcaacgacaatggcaatttgatgtttatagtcgtgatgttgaattggctaataaa
atggaaagtgctggattacccggacgagtacatatatcggagaagacattaaattttttg
gatggtgaatttgaaatcattgatggtgatggtgcatcacgtgaagaagttgttcgttta
tccggtataaaaacctattttattacgaaaattatcaaaccgtatcctgaaggaacattg
gatgctatgattcaaatggatattccaaacgcagatgattgtggagagacaacaaaatta
aaaaatgatataaatgttgatcgttttcgacaagaagatataaaagatccagaaatttat
aaacaacgtttacatgctgaactaatacatcgtgaaagtgaaaaaaatattgccgaacat
acggatttatttagtttaacatttaaaaattcagatattgaacaagaatatcgtgaaagt
cgtgatataacaagttgcatatcattattaggccttccatttacattatttatttattta
ttatcatttgttttaattgggccattttgtttacaaatttatttaacccttgttatttgc
cttttattgctcattgttaaagcatttatttgtactatatcaatcatatggacgtcaatt
ccaaaaccattagctatactgtcaaatgctgtacagcaaaaatcatggatacgtgttaca
attgccggtagtatgattgctttatggataacagcacatattgtagccaatatattctat
gatgataatcttgaaaatgaatatgcaaatctaattatttctggatcaactgatcgttat
catattgctgatcatgttattgcattaccacaatatttaatatttttttgtatattaggt
ttattggctataacagtactgactcgtatacaatttctaatgaaagcaacaattatcata
tgtttagcattcatacaatgttttcttatatattttagtttaacatatgcatttaaagtt
tataaacttataaattatcaacaatttattcatagtagacataattatgttattataatt
ataactattgttattggtttgattattattaatagacagtttgaactaatgacaagacga
ttatttttatggcaaaaagatattgatcaacaaaaagaaatggttgctgatatgcgtaga
aaaaatgaagcattagtttataatatattaccacctcatgttgctgttcattttttgggt
aaacgtaaaaatgatgaggaattatatagtaaaagttatgaatgtgttggtgtattattt
gcatcaatgccaaattttgctgatttttatacagaagaatctgttaataatcaaggatta
gaatgtttaagatttttaaatgaagttatatccgattatgattcattattatcacaacaa
cgttttaaagatatatttaaaattaaaacaataagctcaacatatatggctgctagtgga
ttgaatattgatgaaacaaatgattgttcaaaatcaaataatattattgaaaaatggtca
catttagcacaattaactgaatttgcattaacaatgaaagaaacattgaatggtattaat
aaagaaagttttaataatttcgtattacgtatcggtatcaatcaaggaccaataacggct
ggtgtaattggtgcacgtaaaccacattatgatatttggggtaatacggttaatgttgct
agccgtatggaaagtactggaaaagctggttgcattcaggttgtacaggaaacaatggaa
attttaaaagaatttaatttcatttttgaacaacgtggactagtcagtgttaaaggcaaa
ggaaaattaatgacttattatttgattggaaagaaaaaatgaaaattgaaaaatcttttc
acaaaaaaaaaattgctcatcacccgatcatcactgataaactttgattttgaaaacctg
aaaaacaaacccatttcttga

DBGET integrated database retrieval system