KEGG   Dermatophagoides pteronyssinus (European house dust mite): 113793994Help
Entry
113793994         CDS       T05775                                 

Definition
(RefSeq) uncharacterized protein LOC113793994
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
dpte  Dermatophagoides pteronyssinus (European house dust mite)
Pathway
dpte03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:dpte00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    113793994
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dpte03400]
    113793994
Enzymes [BR:dpte01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     113793994
DNA repair and recombination proteins [BR:dpte03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     113793994
 Prokaryotic type
     113793994
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDG Phage_FRD3
Motif
Other DBs
NCBI-GeneID: 113793994
NCBI-ProteinID: XP_027199873
LinkDB All DBs
Position
Unknown
AA seq 287 aa AA seqDB search
MSKQKTITNFFKRKIIDEIDNGAISKKHCINAVVGGGDDSSNDKRSNDNSGDNRNDDDRR
RVACGYISTKWYKIFEQEFQKQYFKNLEKFIENERNSHTIYPPENQVFSWSFHCDIDNVK
VIILGQDPYHGPRQANGLAFSVERNVAKPPSLINIFKEIKNEYPEFQIPSHGDLKQWSNQ
GVLLLNASLTVRSNQPNSHSNHGWEQFTDSIIRYLNQHYSNRVFLLWGSYAHKKGSFIDS
KKHLVLKSVHPSPLSAMRGFFGCNHFKQCNDYLQKHNIKPIDWTKLD
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaacaaaaaacgataacaaattttttcaaacgtaaaattatcgatgaaatcgat
aatggagcgatcagtaaaaagcattgcatcaatgcagtcgtcggcggtggtgatgattct
tcaaatgacaaacgatctaatgataattctggtgataaccgtaatgatgatgatagacga
cgtgttgcttgtggatatatttcaacaaaatggtataaaattttcgaacaagaatttcaa
aaacaatattttaaaaatttagaaaaattcattgaaaatgaacgaaattcgcatacaatt
tatccacctgaaaatcaagtattcagttggtcatttcattgtgatatcgataatgttaag
gtgattattttaggtcaagatccatatcatggtccacgacaggctaatggtcttgcattc
agcgttgaacgtaatgttgctaaaccaccgagcttaatcaatatattcaaagaaattaaa
aatgaatatcctgaatttcaaataccatcacatggtgatttaaaacaatggtcaaatcaa
ggtgtattattattgaatgcatcactaactgtacgttcaaatcaaccaaattcacattca
aatcatggttgggaacaatttactgattcaataattcgttacctaaatcaacattattca
aatcgtgtttttttactttggggtagttatgcacataaaaaaggttcatttattgattcg
aaaaaacatttagttttaaaatccgtacatccaagtccattatcagcaatgcgtggtttt
ttcggttgtaatcattttaaacaatgtaatgattatctacaaaaacataatattaaacct
attgattggactaaattggattaa

DBGET integrated database retrieval system