KEGG   Dermatophagoides pteronyssinus (European house dust mite): 113794406Help
Entry
113794406         CDS       T05775                                 

Definition
(RefSeq) uncharacterized protein LOC113794406
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
dpte  Dermatophagoides pteronyssinus (European house dust mite)
Pathway
dpte00562  Inositol phosphate metabolism
dpte01100  Metabolic pathways
dpte04068  FoxO signaling pathway
dpte04070  Phosphatidylinositol signaling system
dpte04140  Autophagy - animal
dpte04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:dpte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    113794406
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    113794406
   04070 Phosphatidylinositol signaling system
    113794406
   04150 mTOR signaling pathway
    113794406
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113794406
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dpte01009]
    113794406
Enzymes [BR:dpte01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     113794406
    3.1.3.48  protein-tyrosine-phosphatase
     113794406
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     113794406
Protein phosphatases and associated proteins [BR:dpte01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    113794406
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase CDKN3
Motif
Other DBs
NCBI-GeneID: 113794406
NCBI-ProteinID: XP_027200330
LinkDB All DBs
Position
Unknown
AA seq 605 aa AA seqDB search
MVEYFHDFKMSLGLKEIVSKNKLRYKEDDISRNIIAMGFPAETLERIYRNNINEVVKFFE
EKHKNHYKIYNLCSETKRRYDISKFKGMVVEQYSFQDHNPPPFYMLKEFCESLHKWLNSD
PNNVAAIHCKAGKGRTGLMICAYLVYTGKCIDEQGKFVSIDNADAALEYYGRQRTRDLKG
VTIPSQKRYVHYFEYLVKHNLEYRPSQFRLSSLILTSIPVNNGGAYTLICEIYQIPKQKI
ESFEIEVKKGQKFLLFNLPQPLIIHGDVKLEFYIKKMKKKLFQFCFNTFFVGCGYDTDTY
TIITEPCPHCPNGERISIPISTPLSSGEIDNECNRGKSLFMRKNSNDHQSVIDLSFFDSI
KNESSFDPCDCANSILFQSSFEIFDSTNNVQDFCSNHISSYNNPLFTSQQLPNTSVSSFK
SSSTSSSNSSSTQSLCNNTCNHVNFNGKKTSNPDLMQTFNQEKSLYLVLPKENLDQAYKD
KSNKIFPADFKVVLKFNQDSFDGVDTTILSTNDQYICNDSNCNPYGYSESENITSEDDDD
PSDQELNNGSSNHSTLTMKQTSFEPNNHNHNHKHQVVQANQSSSSSEFETNNNSLENKKG
EITYL
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atggttgaatattttcatgatttcaaaatgtcccttggtctcaaggagattgtttcgaaa
aacaaactccgttataaagaagatgatatttcgaggaatataattgctatgggatttcca
gccgaaacattagaacgaatatatcgtaacaatattaatgaggtggtcaaattttttgaa
gaaaaacataaaaatcattataaaatatacaatctttgttctgaaacaaaacgtcgttat
gatatatcaaaatttaaaggaatggttgtggaacaatattcatttcaggatcataatcct
ccgccattttatatgttgaaagaattttgtgaaagcctacataaatggttgaattccgat
ccaaacaatgttgctgccatacattgtaaagcaggaaaaggacgtaccggtttaatgatc
tgtgcatatcttgtttataccggaaaatgtattgatgaacaaggaaaatttgtaagcatt
gataatgctgatgcggcactcgaatattatggccgacaacgaacacgtgatcttaaagga
gtgacaataccttcacaaaaacgttatgttcattattttgaatacctagtcaagcacaat
ctcgaatatcggcccagccagtttaggctttcatctttgattttaacttcaataccggta
aataatggtggtgcctatacgttgatctgtgaaatttatcaaataccaaagcaaaaaatc
gagtcatttgaaatagaagtaaagaaaggccaaaaatttctgttatttaatctaccacaa
ccgttgattattcatggtgatgttaagctagaattttatatcaaaaaaatgaaaaagaaa
ttgtttcaattttgtttcaacacattttttgttggctgtggttacgataccgatacgtat
acgatcataaccgaaccatgtccccattgtccaaatggagaacggatatccattcctatt
tctactcctctcagttcaggagaaatcgacaatgaatgcaatcgcggaaaatcattgttc
atgaggaaaaattcaaatgatcatcaatctgtgattgacttatcattttttgattcgatc
aagaatgaaagcagttttgatccctgtgattgtgcaaattcaattttatttcaatcatca
ttcgaaatttttgattcaaccaacaatgtccaagatttttgtagcaatcatatttcaagt
tataataatcccttgtttacatcgcaacaactaccaaacacatcagtatcatcctttaaa
tcatcatcaacatcgtcttcgaatagttcatcaacacaatcgttgtgtaataatacttgt
aatcatgtgaattttaatggtaaaaagacgagcaatccggatttgatgcaaacatttaat
caggaaaagagtctttatctagtattaccgaaagagaacctcgaccaagcatataaagat
aaatctaacaaaatttttcctgccgatttcaaggttgtattaaaatttaatcaagattca
ttcgatggtgttgatactacaattctatcaacgaatgatcaatatatttgtaatgattca
aattgcaatccatatggttacagtgaaagtgaaaatattacctctgaagatgatgatgat
ccatccgatcaggaattgaataatggtagtagtaatcattcaacattgacgatgaaacaa
acatcattcgaaccgaataatcataatcataatcataaacatcaagtggtacaagcaaat
caatcatcatcatcatctgaatttgagacgaataacaatagtttagaaaataaaaaaggt
gaaataacctatctttga

DBGET integrated database retrieval system