KEGG   Dermatophagoides pteronyssinus (European house dust mite): 113795639Help
Entry
113795639         CDS       T05775                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SMYD3-like
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
dpte  Dermatophagoides pteronyssinus (European house dust mite)
Pathway
dpte00310  Lysine degradation
dpte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpte00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    113795639
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dpte03036]
    113795639
Enzymes [BR:dpte01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     113795639
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     113795639
Chromosome and associated proteins [BR:dpte03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     113795639
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET zf-MYND zf-C6H2
Motif
Other DBs
NCBI-GeneID: 113795639
NCBI-ProteinID: XP_027201645
LinkDB All DBs
Position
Unknown
AA seq 326 aa AA seqDB search
MYYCGIDCQKKDWIQHKLECKIYKENFDQLNLTGLQEDLLFRLMLRLNMFLKDKPFRLWE
HRKFLNDENSFVCLIDIKNQKPPTFHRKKFFHFLSMGQQSNSRNIDWTIKMLCRDICYDY
GLNIFNYELQPLGLGLYLAESQLKHSCSPDVSILFNGTQLVMRTTRPIKSGEQITVNFFK
FINETIPFKSGPVSMILPTLPHPCDECVSKTSMIKKELNEMYEKAMSSYLNKIFEFPIFK
KYLSFISQYCNECDFGLLLLKIIILENYALDNDVEELSVVELAKNLEITLPSVYNEIFKN
IYFDREEVAHVSLMKALANVEFNVEN
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtattattgtggaatagattgtcagaaaaaagattggattcaacataaattggaatgt
aaaatttataaagaaaattttgatcaactcaatttaactggactacaagaggatttactt
tttcgacttatgttacgattgaatatgttcttgaaagacaagccatttcgtttgtgggaa
catcgtaaatttttaaacgatgaaaattcatttgtatgccttattgatatcaaaaatcag
aaacctccaacgttccatcggaagaaattttttcattttttgtccatgggccaacaatcc
aactcaaggaatattgactggacgataaagatgttatgtcgtgatatatgttacgactat
ggtttgaatattttcaattatgaattgcaacctttaggcttaggtttatatttggccgaa
tcacaattgaaacattcctgttcaccagatgtttcaatcttgttcaatggtactcaactt
gtaatgcgtacaacaagaccgatcaaatctggtgaacaaattaccgtcaatttttttaaa
tttattaatgaaacaataccttttaaatcgggaccagtatcgatgatccttcctactttg
ccacatccatgtgatgaatgtgtatcgaaaacttcaatgatcaaaaaagaattgaatgaa
atgtatgaaaaagctatgtccagctatttgaacaaaatatttgaatttccaatttttaag
aaatatttgtcatttataagccagtattgtaatgaatgtgattttggtctacttttacta
aaaattattatattagaaaattatgcacttgacaatgatgttgaagaattatcggttgta
gaattggcaaaaaacctagaaattacacttccgtctgtttacaatgaaatatttaaaaat
atctattttgatcgtgaagaagtggcacatgtttcccttatgaaagcattggcaaatgtt
gaattcaatgttgaaaattga

DBGET integrated database retrieval system