KEGG   Dermatophagoides pteronyssinus (European house dust mite): 113798025
Entry
113798025         CDS       T05775                                 

Definition
(RefSeq) uncharacterized protein LOC113798025
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
dpte  Dermatophagoides pteronyssinus (European house dust mite)
Pathway
dpte04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:dpte00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    113798025
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 113798025
NCBI-ProteinID: XP_027204304
LinkDB
Position
Unknown
AA seq 151 aa
MKAITMTDISRTTLWTSNNDTHGHCHYSSRGWKSSNRSSQQDLFRPVTTTTTTHDENSNF
KSSNSKLNRSLFGQTDPIETKRFLYEEMNSRRIIDRNRWNFDFHTEKPLQGRYEWHKLTR
SDTTTTTSTTNSPPQSPFDRRTPSPKFFSNH
NT seq 456 nt   +upstreamnt  +downstreamnt
atgaaagctatcacaatgaccgatataagtcgtacgacattatggacatcgaataatgat
acacatggccattgtcattattcatcacgtggatggaaatcatcaaatcgttcatcacaa
caggatttatttcgtccagtcacaacaacaacaacaacacatgatgaaaattcaaatttt
aaatcatcaaattcaaaattaaatcgatcattatttggtcaaaccgatccaattgaaaca
aaacgttttctttatgaagaaatgaattctagacgaattatcgatcgtaatcgttggaat
tttgattttcatacggaaaaaccgcttcaaggccgttatgaatggcataaattaacccgt
tcagatacgacaacaacaacatcaacaacaaacagtccaccacaatcaccatttgatcgt
cgtacaccaagtcctaaatttttttccaatcattaa

DBGET integrated database retrieval system