KEGG   Dermatophagoides pteronyssinus (European house dust mite): 113799754Help
Entry
113799754         CDS       T05775                                 

Definition
(RefSeq) serine/threonine-protein kinase A-Raf-like
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
dpte  Dermatophagoides pteronyssinus (European house dust mite)
Pathway
dpte04068  FoxO signaling pathway
dpte04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:dpte00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    113799754
   04150 mTOR signaling pathway
    113799754
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dpte01001]
    113799754
Enzymes [BR:dpte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     113799754
Protein kinases [BR:dpte01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   113799754
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase RBD C1_1 Kinase-like zf-RING-like APH Kdo
Motif
Other DBs
NCBI-GeneID: 113799754
NCBI-ProteinID: XP_027206246
LinkDB All DBs
Position
Unknown
AA seq 924 aa AA seqDB search
MNIDQQQQQQQNSNQIQMESKTLIRRTSAEPYISFNEKQSLNNKNLLMINNNSNNKDDKT
TTTKQQQRRSTTTTTTTESESTTTTATGTTKKRHSISVSNLTILTNSLLTVASFADAKSS
QFLSYLKNGCQLANNNNHISQMTTNTINDNDKNSNLNDHNNNNNNNDDERRKDSINSLII
DYGFQGKIIRAHLPDDQRTIVPIQSGQTIRDVLEKSMDRRKLTSDMCTVYICDTNEPIDW
DSDVSLLNPGAEIRVKTNEPFPIQTRISHNYIRKTFFTLEFCECCNRILFHGFRCQTCGI
RFHTRCALQVPSLCQPLRIDNYYRHLLAMNANNMLNNPQTGCINRCGFYRSASINNHHYQ
QQQKQQQNSSIKLSKQQLKIKITNKNQNETINNDNDDNNQLSTNFLRPDLQSSQQQQSQH
SRERSTSAPNVCFNSTTINTDNNNEHTKTIIDNQNNDNTKLRLKRPTTSPNKLNKLIDPS
LSSSTTTTSTKTTMTLNNNNNNGGSGRPRARSADESIKINNKIQNTSVSYRESIEDWEIP
QDEILVGPRIGSGSYGTVYRGHWHGPVALKKLKVIEPTETQLQEFKNELTVLRKTRHVNI
ILFMGCVSKPHLTIVTQWCEGSSLYKHLHVFETNFEIIQLIDIARQTAQGMDYLHAKHII
HRDLKSNNIFLHNDFTVKIGDFGLATVKSRWKGSKKFQQPTGSILWMSPEIIRMIEPNPY
SFQSDVYSFGIVLYELTTGTLPYRHVNNKDQILFMVGRGYLKPDLSLLRDNIPKRFVQLL
KDCIQFDFIKRPLFRQILSRIENILQLLPKFDRSRSEPSIYDHNNHQSLLSSSNIDDDPD
LIIFTNNNNNNFITKPIITTKNCTAANVDANKIATESSSSSSIIYQSPNDIEYIPESSES
ASTTTTTTAKLIEQPFTYFVTENI
NT seq 2775 nt NT seq  +upstreamnt  +downstreamnt
atgaatattgatcaacaacaacaacaacaacaaaattcaaatcaaattcaaatggaatct
aaaacattaatacgtcgtactagtgctgaaccatatattagttttaatgaaaaacaatca
ttaaataataaaaatttattaatgatcaataataatagtaataataaagatgataaaaca
acaacaactaaacaacaacaaagacgatcaacaacaacaacaacaacaacagaatcagaa
tcaacaacaacaacagcaacaggaacaacaaaaaaacgtcattcaatatcggtctcaaat
ttaacaatattaacaaatagtttattaacagttgcatcatttgctgatgcaaaaagtagt
caatttttatcatatcttaaaaatggttgtcaattagctaataataataatcatatatca
cagatgaccaccaatactatcaatgataatgataaaaatagtaatcttaatgatcataat
aataataataataataatgatgatgaacgacgtaaagattcaataaattcattaataatt
gattatggatttcaaggtaaaataattcgtgcacatttacctgatgatcaacgtacaatt
gtaccaatacaatctggacaaacaatacgtgatgtattggaaaaatcaatggatcgtcgt
aaattaacatccgatatgtgtactgtttatatttgtgatacaaatgaaccaatcgattgg
gatagtgatgtatcattattaaatccaggtgctgaaatacgtgtaaaaacaaatgaacca
tttccaatacaaacacgtatatcacataattatatacgtaaaacattttttacattagaa
ttttgtgaatgttgtaatcgtatattatttcatggttttcgttgtcaaacatgtggtata
cgttttcatactagatgtgcattacaagtaccaagtttatgtcaaccattacgtattgat
aattattatcgtcatttattagcaatgaatgctaataatatgttaaataatccacaaact
ggttgtattaatcgttgtggtttttatcgttcagcatcgattaataatcatcattatcaa
caacaacaaaaacaacaacaaaattcatcaataaaattatcaaaacaacaattgaaaata
aaaattacaaataaaaatcaaaatgaaacaattaataatgataatgatgataataatcaa
ttatcaacaaattttttacgaccagatttacaatcatcacaacaacaacaatcacaacat
tcacgtgaacgttcaacatcagcaccgaatgtttgttttaattcaacaacaattaatact
gataataataatgaacatactaaaacgataatcgataatcagaataatgataatacaaaa
ttacgtttaaaacgtccaacaacatcaccaaataaattaaataaacttattgatccatca
ttatcatcatcaacaacaacaacatcgacaaaaacaacaatgacattaaataataataac
aataatggtggcagtggtagaccacgtgcaagatcagccgatgaatcaataaaaattaat
aataaaatccaaaatacatctgtatcatatcgtgaatcgattgaagattgggaaatacca
caagatgaaatattagttggtccacgtattggttccggttcatatggtactgtttatcgt
ggacattggcatggaccagttgcattaaaaaaattaaaagtaatcgaaccaactgaaaca
caattacaagaatttaaaaatgaattaactgttttaagaaaaacacgtcatgttaatata
atattatttatgggttgtgtatcaaaaccacatttaacaattgttacacaatggtgtgaa
ggttcatcattatataaacatttacatgtttttgaaacaaattttgaaattattcaattg
attgatattgctcgacaaacagcacaaggaatggattatctacatgctaaacatattata
catcgtgatcttaaatcaaataatatttttctacataatgattttactgtaaaaattggt
gattttggcctagcaacagtcaaatcacgttggaaaggttcgaaaaaatttcaacaacca
actggttcaatattatggatgtcaccagaaattatacgtatgattgaaccaaatccatat
tcatttcaaagtgatgtttattcattcggtattgtattatatgaattaacaaccggtaca
ttaccatatcgtcatgttaataataaagatcaaatattatttatggttggacgtggttat
ctaaaaccagatttatcattattacgtgataatattccaaaacgttttgtacaattatta
aaagattgtatacaatttgattttataaaacgaccattatttagacaaatattatcacgt
attgaaaatatattacaattattaccaaaatttgatcgttcacgttcagaaccatcaatt
tatgatcataataatcatcaatcattattatcatcatcaaatattgatgatgatccagat
ttaattatttttacaaataataataataataattttataacaaaaccgataataacaaca
aaaaattgtacagccgcaaatgtagacgcaaacaaaatcgcaaccgaatcatcatcatca
tcatcaataatttatcaatcgccaaatgatattgaatacattcccgaatcatctgaatcc
gcatcaacaacaacaacaacaacggccaaattaatcgaacaaccatttacctattttgta
actgaaaatatttag

DBGET integrated database retrieval system