KEGG   Deinococcus puniceus: SU48_01350Help
Entry
SU48_01350        CDS       T04339                                 

Definition
(GenBank) cysteine ABC transporter substrate-binding protein
  KO
K02424  L-cystine transport system substrate-binding protein
Organism
dpu  Deinococcus puniceus
Pathway
dpu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:dpu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SU48_01350
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dpu02000]
    SU48_01350
   02035 Bacterial motility proteins [BR:dpu02035]
    SU48_01350
Transporters [BR:dpu02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Cystine transporter
    SU48_01350
Bacterial motility proteins [BR:dpu02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    SU48_01350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd NMT1 Phosphonate-bd
Motif
Other DBs
NCBI-ProteinID: ANE42630
UniProt: A0A172T6M4
LinkDB All DBs
Position
275801..276565
Genome map
AA seq 254 aa AA seqDB search
MKRTLILSALALSLATTAAAQRPTTLTPGVLKIGMEGTYAPFTFKDEKGQLVGFDVDIAK
AVAARLGLKPEFVLTEWSGILAGLQARKYDVIVNQVGITAERQKAIGFSNAYAYSSPQII
VRKNATTAFKNLADLKGKRVGVGLGSNFEQQLRGAGGINVVTYPGAPEYLSDLISGRIDA
AFNDRLLVGYLIKKDGLPVKGAGVIGAAEPVGIAFRKDNTSLKTAIDRALLQIKANGTYA
KISRQWFGQDVSKP
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcaccctgatcctgtccgcccttgccctgagcctcgccactaccgccgctgcc
cagcgccccaccactctcacccccggcgtgctgaaaatcggcatggaaggcacttacgcg
ccgtttaccttcaaggacgaaaagggccaactggtgggcttcgacgtggacattgccaaa
gctgtggccgcccgccttggcctgaagcccgagtttgtactgaccgagtggagcggcatt
ctggccggactgcaagcccgcaaatacgacgtgatcgtgaatcaggtgggcattaccgcc
gagcgccaaaaagccatcggcttcagcaacgcttatgcctacagcagcccgcagatcatc
gtgcggaagaatgccaccaccgccttcaaaaacttggcggatctgaagggcaagcgcgtg
ggcgtgggcctcggcagcaacttcgagcagcaattgcgcggcgcaggcggcatcaatgtg
gtcacgtaccccggcgctcccgaataccttagcgacctgatttcgggccgcatcgacgcc
gcgttcaatgaccgcctgttggtgggctacctgatcaagaaagacggcctacccgtgaag
ggtgcgggcgtgatcggcgcggcagaacccgtaggaatcgccttccgcaaagacaacacc
agcctgaaaaccgccattgaccgcgccctattgcagatcaaggccaacggcacctacgcc
aagatcagccgccagtggttcggtcaggatgtcagcaagccctga

DBGET integrated database retrieval system