KEGG   Deinococcus puniceus: SU48_02680Help
Entry
SU48_02680        CDS       T04339                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
dpu  Deinococcus puniceus
Pathway
dpu00020  Citrate cycle (TCA cycle)
dpu00270  Cysteine and methionine metabolism
dpu00620  Pyruvate metabolism
dpu00630  Glyoxylate and dicarboxylate metabolism
dpu00680  Methane metabolism
dpu01100  Metabolic pathways
dpu01110  Biosynthesis of secondary metabolites
dpu01120  Microbial metabolism in diverse environments
dpu01130  Biosynthesis of antibiotics
dpu01200  Carbon metabolism
Module
dpu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dpu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dpu_M00012  Glyoxylate cycle
dpu_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:dpu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SU48_02680
   00620 Pyruvate metabolism
    SU48_02680
   00630 Glyoxylate and dicarboxylate metabolism
    SU48_02680
  09102 Energy metabolism
   00680 Methane metabolism
    SU48_02680
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SU48_02680
Enzymes [BR:dpu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     SU48_02680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C
Motif
Other DBs
NCBI-ProteinID: ANE42846
UniProt: A0A172T7E1
LinkDB All DBs
Position
582087..583079
Genome map
AA seq 330 aa AA seqDB search
MTTKPPVRVAVTGAAGQIGYSLLFRIASGDMLGKDQPVILHLLEITPALKALNGVVMELR
DCAFPLLADIVTSDDPMVAFKDIDYALLVGAMPRKAGMERGDLLSANGGIFKPQGEALNA
VASRNVKVLVVGNPANTNALIAQQNAPDLNPGQFTAMVRLDHNRAISQLAEQTGKPVSSI
QNLTIWGNHSSTQYPDLSAATVDGQPALDLVERDWYENSYISTVAKRGAAIIEARGLSSA
ASAASAAIDHMRDWALGTPEGQWVSMGIPSDGSYGVPAGLIYGFPVTCKNGQYEIVQGLE
VSDFSRGKMDATAQELTEERDEVRKLGLVK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccaaaccacccgttcgcgttgccgtcactggcgcagccggacagatcggctac
agcctgctgttccgcatcgcgtccggcgacatgctgggcaaagaccagcccgtgatcctg
catctgctggaaatcacgcccgcgctcaaggccctcaacggcgtcgtgatggaactccgc
gactgcgctttcccgctgctggccgacatcgtgaccagcgatgatccgatggtggccttc
aaggacatcgattacgccctgctggtgggcgcgatgccccgcaaagctggcatggaacgc
ggcgacctgctgagtgccaacggcggcatcttcaaaccgcagggtgaggcgctgaatgct
gtggcgagccggaacgtgaaagtgctggtggtgggcaaccccgccaacaccaacgccctg
atcgcccagcaaaacgcccccgacctgaatcctggacaattcacggcgatggtgcgcctc
gaccacaaccgcgccatttcgcaattggccgagcagaccgggaagcccgtcagtagcatt
cagaatctgaccatctggggcaaccactccagcacgcagtaccccgacctgagcgccgcc
acggtagacggccagcccgcccttgatctggtggagcgcgactggtacgagaacagctac
atttctacggttgccaagcgtggcgcggccattatcgaagcacgcggcctcagcagcgcg
gccagtgccgccagcgccgccatcgaccatatgcgcgactgggcgctgggcacgccggaa
ggccagtgggtcagcatgggcattcccagcgacggcagctacggcgttcccgctggcctg
atctacggcttccccgtgacctgcaagaacggccaatacgagatcgtgcaaggtctggaa
gtcagcgacttcagccggggcaaaatggacgccaccgcgcaggaactgaccgaggaacgc
gacgaagtacgcaaactgggcttggtcaagtag

DBGET integrated database retrieval system