KEGG   Deinococcus puniceus: SU48_08800Help
Entry
SU48_08800        CDS       T04339                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
dpu  Deinococcus puniceus
Pathway
dpu00620  Pyruvate metabolism
dpu00680  Methane metabolism
dpu01100  Metabolic pathways
dpu01120  Microbial metabolism in diverse environments
dpu01200  Carbon metabolism
Module
dpu_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:dpu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SU48_08800
  09102 Energy metabolism
   00680 Methane metabolism
    SU48_08800
Enzymes [BR:dpu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SU48_08800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: ANE43859
UniProt: A0A172TA21
LinkDB All DBs
Position
1928661..1931174
Genome map
AA seq 837 aa AA seqDB search
MGIRNDVNLLGRTLGQVLKEQEGEAFFDLVERTRALVREVRGGGDDSELRALIGGLNEAD
AGNLTRAFTWYFQLVNLAEEYERVRVLSGSQGTRPQSIEGALVELKAQGVSAIEAEALLA
RLDLGLTFTAHPTEMRRRTIRSHLVEVARAIPDLHSQDESAVERVAAHVEAMWTTPELRR
LKPTVLDEVKGGLNYVTSIAQALPALQRDLQRAFRTVYGRDTAAQVPLSFSSWMGGDRDG
NPFVTPQATAGALEIHRQRAREVLLSAIKQAYADLSQEGNTEDSPDSYREELRDLHNSVR
DGLPVELLPRLEALRERLRAEGQQRSADQLLTPLLTVARVFGQHLVSLDVREHSAQTGAA
VAELLAAAGVEANYLALPEHAKLELLTRELRSRRPLWPAGEALTDTLETAIGPIREVQAA
TRLVGPRAFGHYVISMSESVSDVLEPLLLAREVGFAILPVPLFETLADLERAPQVVWELL
SLPEYRAVLGDSVQEIMLGYSDSNKDAGFLAANWALHEAQRKISDVCRRAGVHWRFFHGR
GTSIGRGGGPASRAILGQPAGTIDAGIRITEQGEALADKYSHPVLARRNLEQALYGLMLA
AARPALDPPQEWMDALDRAARVSARAYRTLVDDADFIPFFERVTPIHEISRLNIASRPVR
RPGAPTLGNLRAIPWVMSWTQNRANLPGWYGLTEGIREIGVEQARAMYADWPFFRTVLDN
SQMSLAKSDPLIFCEYLTLLDNGEGTAEGSARLAEHLKYSYRDAVEAVQSVIGAELLGNE
PRLRESIALRNPYIDPIHRIQVELLRRARATEHGLDEYERPLLLSLQGVAAGVRNTG
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atgggcattcgcaatgacgtaaatctgctggggcgcacgctggggcaagtgctgaaggaa
caggaaggcgaggcgttttttgatctagtggaacgcacgcgggcgttggtgcgcgaggta
cgcggcggcggcgacgactcggaattgcgggcgctgatcggcgggctgaacgaggccgat
gcgggcaacctgacgcgggccttcacgtggtacttccaacttgtgaatctggccgaggaa
tacgagcgggtgcgggtgctgtcgggatcgcagggcacgcgcccacagagcatagagggc
gcactggtagagctgaaggcgcagggcgtgagcgctattgaggccgaagcattgctggcc
cgccttgatttgggcctcacgtttaccgcccaccccaccgagatgcgccgccgcaccatt
cgcagccatctggtcgaggtggcccgcgccattcccgacctgcacagccaagacgaatcg
gcggtagagcgtgtggccgcgcacgtggaagccatgtggacgacccccgaactgcgccgc
ctgaaacccaccgtgctggatgaagtcaagggcggtctgaattacgtcacttccattgca
caggcactcccggcgctccagcgcgaccttcagcgggccttccgcacggtgtatgggcgc
gacacggcggcccaagtccccctcagtttcagttcttggatgggcggtgaccgcgacggc
aaccccttcgtgaccccgcaggccactgccggagcgctggaaattcaccggcaacgggcg
cgggaagtgctgctgagcgcgataaaacaggcgtatgccgatctgagtcaggagggaaac
acagaagattcccccgacagctaccgcgaagagctgcgtgacctgcacaattcggtacgc
gatgggttgcctgtagaactcctgccgcgcttggaagccctgcgcgagcgactgcgcgcc
gaaggccagcagcgcagcgccgatcaactgctgacgcccttgctgacggtggcccgcgtg
ttcgggcaacatctggtgagcttggatgtccgcgaacacagcgcgcagacgggagcagcg
gtggccgaactgctggcggcggcaggcgtggaggccaactatctggccctgcccgaacac
gccaagttggaactgctgacccgcgaactgcgctctcgccgcccgctgtggcctgcggga
gaagccctgaccgacacgctggaaaccgccatcggccccattcgggaagtgcaggcggcg
acccgattggttggcccccgcgctttcggacattacgtgatcagcatgtcggaaagcgtg
tcggacgtgctggagccgctgctgctggcccgcgaggtggggtttgccatcctgcccgtg
cccctgttcgaaacgttggccgacttggaacgtgccccgcaagtggtctgggagttgctg
agcctgcccgaataccgagccgtgctgggcgacagcgtgcaggaaatcatgctggggtac
agcgattccaacaaagatgcggggtttttggcggcgaattgggccttgcacgaagcgcag
cgcaagatcagcgacgtgtgcaggcgggcaggcgtgcattggcgcttctttcacgggcgc
ggcacctccatcgggcgcggcggtgggcctgcgagtcgggctattttgggccaacccgcc
ggaaccatcgacgccggaatccgcattaccgagcagggcgaagcgttggccgacaaatac
agccaccccgtcttggcccgccgcaatctggaacaagccctgtacggcctgatgctggcc
gccgcccgccccgcgcttgacccgccgcaggagtggatggacgccctagaccgcgccgct
cgcgtgagtgcccgcgcctaccgcaccctcgtagacgacgccgacttcatccccttcttc
gagcgggtcacgcccattcacgaaatctcgcgcctgaatatcgcgtcccgcccggttcgc
cgccccggtgcgcccacgttgggcaacctgcgggccattccgtgggtcatgagctggacg
caaaaccgcgccaatttacccggttggtacggcctgaccgaagggattcgggaaatagga
gtggagcaggcccgcgccatgtacgccgactggccctttttccgcaccgtgctggacaac
agccagatgagtcttgccaaaagcgacccgctgattttctgtgagtacctgaccctcctg
gacaacggcgaaggcacggcagaaggcagcgcccgccttgccgaacacctaaaatacagt
taccgcgacgccgtagaagccgtgcagagcgtgatcggcgcggaactgctgggcaacgaa
ccccgcctgcgcgaaagcattgccctacgcaatccctacattgacccgatccaccgaatt
caggtggaactgctgcgccgcgcccgcgccaccgaacacggtctggacgaatacgaacgc
cccctgctgctgagcttgcaaggcgtggcggcgggagtgaggaatacggggtaa

DBGET integrated database retrieval system