KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_117582Help
Entry
DAPPUDRAFT_117582 CDS       T04347                                 

Definition
(GenBank) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
dpx  Daphnia pulex (common water flea)
Pathway
dpx00020  Citrate cycle (TCA cycle)
dpx00190  Oxidative phosphorylation
dpx01100  Metabolic pathways
dpx01200  Carbon metabolism
Module
dpx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dpx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dpx_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:dpx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DAPPUDRAFT_117582
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DAPPUDRAFT_117582
Enzymes [BR:dpx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     DAPPUDRAFT_117582
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 FAD_binding_3 GIDA DAO HI0933_like
Motif
Other DBs
NCBI-ProteinID: EFX65067
JGI: Dappu1_117582
UniProt: E9HT66
LinkDB All DBs
Position
Unknown
AA seq 596 aa AA seqDB search
MSGKLAAPFSPCLPSCPGRFFDYITVKQKLVLIVFFIVIVGAGGAGLRAAFGLVEKGFKT
AVITKLFSTRSHTVAAQGGINAALRNMEKDDWKWHMYDTVKGSDWLGDQDAINYMTKEDP
HAVIELENYGIHTQDGKIYQRAFGGQSYNYGKGGQAHRCCCVADRTGYSLLHTLYGQSLR
YDCNYFVEYFALDLLMEEGECRGVIALCLEDGSINRLDPRTPFWLREDMVKPSFRVLQLT
LALVTVTPWCLVLDFLFKIWSSFSSILLELTELDVSLPRRSERFMERYAPVAKDLASRDV
VSRAMTIEIPVVAPRRIMYTFTQQLAERSPGISETAMIFAGVDVTREPILVLSTVHYNMG
GDPTNFKGQIITHKDGADVILPGLYAAGEAACVSVHGANRLGANSLLDFVVFGRACALTI
AEENKPSETIGKLSPNAGESSVANLDNGSVTTAELPVFCTGDVLVEGCQKMFDLWSSLHD
IKVADRGLVWNSDLVETLELQNLMLNCIQTIYSAKARKESRGAHAREVFNDRVNEYDFKK
PMGGQQKQPLDQHWPKHTLSWCDQEKGDVTLQYRPVIDETLDEKECASVPPALRLY
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggcaaactggcagctcctttttcaccttgtttgccatcgtgtcccggaaggttt
tttgattacataacagttaaacaaaaattggtattaattgttttttttatagttattgtt
ggtgctggtggtgctggacttcgtgcagcttttggtttggttgaaaaaggattcaaaaca
gctgtgattacaaagctgttttccacccgatcacacactgttgctgcccaaggtggaatt
aatgcagctctgagaaatatggaaaaagatgactggaagtggcacatgtatgacactgtt
aaaggctcagattggcttggagatcaagatgctatcaattacatgaccaaagaagatcct
catgcagttattgagttggagaactatggtatccacacccaagacggcaaaatctaccag
agggcttttggtggacagtcctacaattatggcaaaggtggacaagctcacagatgttgc
tgcgttgctgatcgtactggctattctcttcttcacaccttgtacggacagtctcttcgc
tacgattgcaattacttcgtcgaatactttgctttggatctgttgatggaggaaggcgaa
tgccgtggcgtgatcgccctttgcctggaggacggatccatcaatcgtttagatccaaga
acgccgttctggctacgggaggatatggtcaaaccttcttttcgtgtacttcagctcaca
cttgcactggtgacggtaacgccatggtgtctcgtgctggacttcctcttcaagatttgg
agttcgttcagttccatcctactggaattaacggagctggatgtctcattaccgaggcga
agtgaacgatttatggaaagatacgctccagtggctaaggatttggcctcacgtgacgtc
gtatctcgtgctatgactattgaaatcccggttgtggcccccagaaggatcatgtatacc
ttcacacaacagttggctgaacgctctcctggtatttctgaaacggccatgatttttgca
ggtgttgacgtcactcgtgagccgatcctggtgttgtctaccgtccattacaacatgggt
ggcgatccaactaacttcaagggccagattattacgcacaaagatggagctgatgttatt
ttacctggtttgtacgctgctggagaagctgcctgcgtatccgtgcacggtgctaaccgc
ctgggtgctaattctttgctcgatttcgtcgttttcggccgagcatgtgccctaactatt
gctgaagagaacaagccatccgaaactatcggaaaattgagtccgaacgctggcgaaagt
tccgtggcaaacttggacaatggtagtgtcaccacggccgaacttcccgtcttctgtact
ggagacgttttggtagagggatgtcagaaaatgtttgatctttggtcatcattgcacgac
attaaggtggccgatcgcggccttgtctggaattctgatttggttgagacccttgagctc
cagaacctcatgctaaactgcattcagaccatctacagtgctaaagccaggaaggaatct
cgcggtgcccatgcccgcgaagtcttcaatgatcgtgtcaatgaatacgacttcaagaag
ccgatgggaggtcaacagaagcaacctctagatcagcactggcccaagcacacactctcc
tggtgtgatcaggagaaaggagatgtcactctgcagtaccgtcccgtcatcgatgaaaca
ttagacgagaaagagtgtgcgtcggttccccccgcattgcgcttgtattaa

DBGET integrated database retrieval system