KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_202050Help
Entry
DAPPUDRAFT_202050 CDS       T04347                                 

Definition
(GenBank) hypothetical protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
dpx  Daphnia pulex (common water flea)
Pathway
dpx00052  Galactose metabolism
dpx00500  Starch and sucrose metabolism
dpx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    DAPPUDRAFT_202050
   00500 Starch and sucrose metabolism
    DAPPUDRAFT_202050
Enzymes [BR:dpx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     DAPPUDRAFT_202050
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase DUF3382
Motif
Other DBs
NCBI-ProteinID: EFX70862
JGI: Dappu1_202050
UniProt: E9HBL0
LinkDB All DBs
Position
Unknown
AA seq 604 aa AA seqDB search
MARSSSDSSDDERKTVRIGPAPPIPKKTYATKSSTMQKRKKQCCLLIRKKWFIAAISAFI
LLLILAIVLGVTLGGKNKSVVYSNPVNLTWWQNSTIYRCYVTSYVDSDGDGIGDFKGIQE
RLSYLKELGVDVLWLSPIQNTNTVSGTDVINAKQVKIEYGLQQDFRDLVAAAKEMGIRVI
MDIILNHSGSAHQWFRQSQLSTNPYKDYYIWSKGKLGGLNDTKPLPPNNWISLYNGSAWQ
WSDSRQEYYLRQFWRNEPDLNYRNPQIIQEMKTAVNFWLELGVDGFYLRDVAFLYEDAQL
TDESQLSSSQEYVFHSHNNTRDLTESYQAVNDIFFGAIQPRMNADRVLLMETNDRVMSDE
KWFQTYNMMTTNALYKLNSTFDGLQLKAVVEHSLEAFNKTHVWPIWSLGDETKSRISSKF
NQLAVGLQVTQIFLPGSSSIYYGEEILLTNNPSITYEQTVDSAAKEAGQSNYNKISRDPF
RTPMKWNSSRNAGFTVATNPWLPVNNNDPTVDLLKSRTNSIWCTIKDMISLKKSSLALTN
GTIEFPMVDVDIFSFTRVHATNNTGFLIVWNVGNQRKTLSFNDVQYISNDMTVIRKVKPE
GSRP
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atggcgagatcatcgtcagacagcagtgatgacgaaagaaaaacggtccggataggacct
gctcctccaatcccgaagaaaacttacgccaccaagagttcaacgatgcaaaagaggaag
aagcagtgttgccttctgatcaggaaaaaatggttcatcgcagcgataagcgcatttatt
ctgctgctcattttggccattgttctgggcgtgactttgggtggaaagaataagtcggtt
gtttacagcaatccagtcaatttgacgtggtggcaaaattccacaatctaccgttgctac
gtgacgtcctacgtcgattctgatggagacggaataggagatttcaaaggaatccaggaa
cgcttaagctatctaaaagaacttggagtcgacgttttatggttgtcacctatccagaat
acgaacacagtgtctggcaccgacgtaatcaacgcgaaacaagttaaaattgaatatggc
ttgcaacaagattttcgggatctcgtcgctgccgccaaagaaatgggaataagggtgatt
atggatataattttgaatcatagcgggagcgcccatcagtggttcaggcagtcgcagttg
tcaacaaacccttacaaagactattatatttggagcaagggtaaattaggagggttaaat
gacactaaacctctacctcccaacaactggatttcactttacaacggctccgcctggcag
tggagtgacagcagacaggagtattaccttcgtcagttttggagaaacgagcccgacctt
aattaccgaaatccgcagattatccaagaaatgaagacggcggttaatttctggttggaa
ttgggggtggatgggttctatctccgcgacgtcgcatttttgtacgaagatgcccagtta
accgacgagagtcagttgagtagctcgcaggaatacgttttccatagccacaataacacc
cgtgacctcactgaaagttatcaagctgtgaacgacatcttttttggcgctattcagcca
cggatgaatgctgacagagtattgcttatggaaactaacgatcgagtcatgagtgatgaa
aagtggttccaaacatataacatgatgacgaccaacgcgctctacaaattgaactcaaca
ttcgacggtttgcaactgaaagctgttgttgaacattcactcgaggccttcaacaaaaca
cacgtgtggccaatctggtcgctaggtgacgagacaaaaagtcgcatctcgtccaaattc
aatcaattggctgtcggattacaagtaactcaaattttcctgccgggttcatcgtccatc
tattatggtgaagagatcctgttgaccaataacccgtcaatcacatacgaacaaacagtt
gacagtgctgccaaggaagctggccaatcgaattataataaaatatcgcgggatcccttc
cgcactcccatgaagtggaactcttcccgaaacgcaggtttcactgtcgcgacaaatcct
tggcttccggtgaacaacaacgacccgactgtcgatttactaaaatccagaaccaattcc
atttggtgcacaatcaaggacatgattagccttaaaaaaagttcgttagcattaacgaat
ggaacaattgaattcccgatggtcgacgtggatatattttcttttaccagagttcacgca
acaaacaataccggattccttattgtatggaatgtcggtaaccagcgcaaaaccttgtct
tttaatgatgtccaatacatctctaatgacatgacagtgatccgcaaagtcaaaccggag
ggaagtcgaccgtga

DBGET integrated database retrieval system