KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_231065Help
Entry
DAPPUDRAFT_231065 CDS       T04347                                 

Definition
(GenBank) hypothetical protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
dpx  Daphnia pulex (common water flea)
Pathway
dpx04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:dpx00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    DAPPUDRAFT_231065
Enzymes [BR:dpx01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     DAPPUDRAFT_231065
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu SEEK1
Motif
Other DBs
NCBI-ProteinID: EFX79040
JGI: Dappu1_231065
UniProt: E9GNE8
LinkDB All DBs
Position
Unknown
AA seq 150 aa AA seqDB search
MASAVCVLLGETVKGVLHFDQQGDVINVKGEVTGLTPGDHGFHVHEFGDYTNGCMSAGPH
FNPTAVEHGGPTDEVRHVGDLGNIVANESGVATVDIKDCLLSLSGVNGIIGRTVVVHADP
DDFGKGGHELSKVTGNAGARVACGIIGIGK
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atggcatctgctgtgtgtgtacttttgggggaaaccgtgaaaggcgtcctacattttgac
caacagggagatgttattaatgttaagggagaagtaactggacttactcctggtgaccat
ggattccatgttcatgagtttggtgactacactaatggttgcatgtctgctggacctcac
tttaacccaactgctgttgaacatggaggtccaactgatgaagttcgtcatgtaggagat
cttggaaacattgttgcaaatgaatctggagttgccactgtcgacatcaaggactgtttg
ctgtccctatctggtgtcaatggaataattggccggactgttgtggtacatgctgatcct
gatgattttggtaagggtggacatgaactgagtaaagtcactggaaatgctggcgctcgc
gttgcttgtggcatcattggcatcggtaaatga

DBGET integrated database retrieval system