KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_300071Help
Entry
DAPPUDRAFT_300071 CDS       T04347                                 

Definition
(GenBank) hypothetical protein
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
dpx  Daphnia pulex (common water flea)
Pathway
dpx00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:dpx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    DAPPUDRAFT_300071
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dpx03036]
    DAPPUDRAFT_300071
Enzymes [BR:dpx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     DAPPUDRAFT_300071
Chromosome and associated proteins [BR:dpx03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     DAPPUDRAFT_300071
   Polycomb group proteins
    PRC2-EZH2 complex
     DAPPUDRAFT_300071
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PRC2_HTH_1 SET preSET_CXC
Motif
Other DBs
NCBI-ProteinID: EFX90346
JGI: Dappu1_300071
UniProt: E9FSB6
LinkDB All DBs
Position
Unknown
AA seq 790 aa AA seqDB search
MRIRQSRRYKRADEIRAVWSENRKNRVAANQKKWEVSKAFWACSQDWPAHSQCMKKVKPD
HCLGVNTDQKAVPVKIINAVAPVPTMYSWAGLQQNFMVEDETVLHNIPYMGDEVLDQDGT
FIEELIKNYDGKVHGDREGGVIDDDIFVELVTALVPYCDEDERSDSGSKSVKAEKLDEAA
RDAMTTIKDKPPKDSVQPVAKDLPNIIAFQAIASVFLDKGTPEELRERYMELTERVDPVA
LGSECTPNIDGPKAPSVQREQAMHSFHTLFCRRCFKYDCFLHRLQSYHPGPNSQKRKCND
LKLPKQPCGPQCYMYLEGLLERLAQAAQEGDEADGQPLKIRKTVSLDSGNEASSEDSNDS
SVKNGNGGNQNPPESVKDDKEIECAMEVVVESQTPPESVAPKVSEPSKDSTPLTSNENSN
SSSSLVPERKNSLNEKPGPSRESKSNESGTSTPLAQAPPAHELNPLKDIDPDVQTVWTPS
EQTLFRVVHPIFLNNYCAIAQTILSKTCKQVYRFAQQEAADLPTLETEKEATPPRKKKKK
LRLWSVHCRKIQLKKDASSNHVHNFTPCDHPGQPCDSTCPCVNAQNFCEKFCQCSSDCQN
RFPGCRCKAQCNTKQCPCFLAVRECDPDLCGTCGADHHDVSKITCKNVSVQRGLRKHLLM
APSDVAGWGIFLKETVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVD
ATRKGNKIRFANHSINPNCYAKVMMVNGDHRIGIFAKRFIHSGEELFFDYRYGPTEQLKF
VGIEREGEFL
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattcgccagtctcggaggtataaacgagctgatgagattcgtgctgtatggtcc
gaaaacagaaagaacagggtggctgccaaccaaaagaaatgggaagtgagcaaagcattc
tgggcatgcagccaagattggccagctcacagtcagtgcatgaagaaagtcaaacctgac
cactgcctgggtgtcaacaccgatcaaaaagcagtgcctgttaagatcatcaatgcagta
gcacctgtccccaccatgtattcgtgggctggtctccaacagaactttatggtggaggat
gaaacagttctacacaacatcccgtacatgggtgatgaagtgttggaccaggatggtacg
tttatagaagaattgatcaagaactacgatggaaaagttcacggagatcgcgaagggggc
gtcatcgatgacgatatctttgtggaactagtcactgccttagtcccctattgtgatgaa
gatgaaaggtctgattcgggttcgaaatccgtcaaagctgaaaagctggacgaagcagca
cgtgatgccatgacaactatcaaagacaaaccacccaaggactctgtccagcccgtagca
aaggatctacccaacatcattgcctttcaagcaatcgcctctgtcttcctagacaaagga
accccagaagaattgagagaaagatacatggaattgacggaacgagttgatcccgtcgct
ctgggtagcgagtgcactccaaatattgacggcccgaaggctccctccgtccagagggag
caagccatgcactcatttcacaccctgttttgtcgccgatgttttaaatacgactgtttt
cttcatcgtctacaatcatatcatcctggtcccaacagtcaaaagagaaaatgcaatgat
ctcaaacttcccaaacagccttgtgggccgcaatgctacatgtacttggaaggtctgttg
gagagattagcacaagcagcgcaagaaggtgacgaagccgatggacagcctcttaaaatc
cgaaaaacggtttcgctagattcgggtaatgaagcttcatccgaagatagcaacgacagt
agcgtcaaaaatgggaacgggggtaaccaaaatccgccggaatctgttaaagacgacaaa
gaaatcgaatgtgcaatggaggtcgtcgtggaaagtcagactccaccggaatctgttgct
cctaaagtgagcgagcccagtaaagattcaacgccactcacgtccaatgaaaattcgaat
agttcttcgagtttggtacctgaacgcaagaatagccttaatgaaaaacctggaccttcg
agggagagcaagtccaatgaatccggtaccagcacgccccttgcgcaagcgccacctgcc
catgagttgaatccgttaaaagacatcgaccccgacgtgcaaactgtgtggacaccatcg
gaacaaactctcttccgagtagtgcaccccattttccttaataattactgtgctattgcg
cagactatcctcagcaagacttgtaaacaggtgtatcggtttgctcaacaagaagccgct
gatctaccaaccctggagaccgagaaagaagccaccccaccgcggaagaagaaaaagaaa
ctacgactctggtccgttcactgccgaaagatccagctaaaaaaagatgcctcatcgaat
cacgttcataattttacgccttgcgatcaccctggccagccttgtgattccacctgccct
tgcgttaatgcgcaaaatttttgtgagaaattctgtcagtgcagttctgactgtcaaaat
cgatttcctggttgtcggtgcaaagctcaatgcaataccaaacagtgcccctgtttcttg
gccgttcgcgaatgcgaccctgatttatgtgggacatgtggtgcggatcatcatgatgtt
tccaaaatcacttgcaagaatgtcagcgttcaacgtggattacgcaagcatctgcttatg
gccccttccgatgttgccggttggggaatatttttgaaagaaacagtacagaagaatgaa
ttcatttccgaatactgtggtgaaataatctcccaggacgaggctgatagacgaggaaaa
gtttacgacaaatatatgtgctcctttttgttcaatcttaacaatgactttgtggttgac
gccaccagaaagggtaacaagattcgctttgctaatcattcgatcaacccaaactgttat
gccaaagtcatgatggtgaacggtgaccacagaatcggtatattcgctaaaaggtttatt
cactctggcgaagagctcttctttgattacagatacggcccaacagagcaactgaaattt
gttggcattgagagagaaggtgaattcctgtag

DBGET integrated database retrieval system