KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_302409Help
Entry
DAPPUDRAFT_302409 CDS       T04347                                 

Definition
(GenBank) hypothetical protein
  KO
K11459  polycomb group RING finger protein 4
Organism
dpx  Daphnia pulex (common water flea)
Brite
KEGG Orthology (KO) [BR:dpx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dpx03036]
    DAPPUDRAFT_302409
Chromosome and associated proteins [BR:dpx03036]
 Eukaryotic Type
  Histone modification proteins
   Polycomb group proteins
    PRC1 (polycomb repressive complex 1)
     DAPPUDRAFT_302409
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RAWUL zf-C3HC4_2 zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-rbx1 zf-RING_5 Prok-RING_4 zf-RING_UBOX zf-C3HC4_4 zf-Nse
Motif
Other DBs
NCBI-ProteinID: EFX66870
JGI: Dappu1_302409
UniProt: E9HN18
LinkDB All DBs
Position
Unknown
AA seq 919 aa AA seqDB search
MHQVSKLQITKLNPHLTCLLCGGYYIEATTIIECLHSFCKSCIVRYLETNKFCPVCEVQV
HKTKPLLNIRSDQTLQDIVYKLVPGLFQHEMRLRREFYSKHPNQLPSNPEDRGEVTDQRP
PRSMEDVKEENESQLNGKRFLRCPAAVTVGLLKRLIRGKYGLDLNHALDILYGDSFLCDE
YSLVDLAYIYNWRRKGPMRLKYRIYQQLQRSSPLTNGTNGSEDAPQKIKEEAVAEDKKMT
NEVQLEISECGVMSVPNVDAKNGIPEETQPIIPNTSSEKPEEVKAPSPKPEASSEAPLVC
VTVSTDISADLNGKTLVNCSPSVDVKTGDSVEVKTTITVNENPTITTGTTSSDTDSNPPA
SHLTSSARNKIPSSTGHKTLKPPSSSWNQNVNRVGTKRPSSSVACNDGGSLNLANAEQTL
PTPSKRATPSSPLKTPRFFKVRNASQPTDTNGGTCKATGTSIASVTESPVQEVAVNLTKA
SSSPKKPTDKERSSREGKEGKAPSPRPDIGSNPIRPYSVPVPSQSKRQPSPNLAAEDAAA
RLRHLLNPISSAASTTTSPSSGDSSVQQLRFPAAAWLNLARGVPNRPVPLALGPGSPFNN
RPPLSPAHFISSFIASHPHYPYLSPMGLPPAPDSKKSLPSSTASSSSSSIPSPQMHKSIS
PRTSNSFPTPTFNLNTLQQCTYPSSLSPLLPNLPRELVGSFYHSSYVPRPFMSARGGPLS
VSPKSVSSSSSVGSNSSGGGFHPSMPPTVTTTTSNSSSSAAGRKSSPGLRPTVPRRNVAP
PPPLVPIGTPSSVRSPPTLLPIKDIVEKESLCAKSTSPAASNCTSVVESCVPQMEEEIVK
SGPVSKSTDGKPVDSTSENQHSPAKENGKVIGDADSGKADTPAASPLECSINKTTTDNAN
VVLENKSESKVEIAAPAPS
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaagtcagcaaattacaaatcaccaagttaaatccacatttgacatgtttgttg
tgtggaggttattacattgaagcaacgactatcatagagtgccttcattctttttgcaag
tcttgcatcgtcagatatctggagaccaacaaattctgcccagtctgtgaagtgcaagtc
cataaaacaaagcctcttctgaatatccgttcagatcaaacccttcaagatattgtctat
aaattagtccctgggctttttcaacatgaaatgcggctcaggagagaattctacagcaaa
caccctaatcagctgccttcaaatccagaggacagaggtgaagtgacagaccaacgacct
ccaaggtcgatggaagatgtgaaagaagaaaacgaaagccagttgaatgggaaacggttt
cttcgatgtcccgctgctgttacagttggcctcctcaaacgtcttattcgggggaaatat
gggttagatttgaatcacgctttagatattctctacggagattctttcctatgcgacgaa
tattcactggtggatctagcttacatctacaactggcggcggaaaggccctatgaggctg
aagtatcgcatttaccaacaattgcaacgctccagtcctttgactaacggcaccaatggt
agcgaagacgccccacagaaaatcaaagaagaagctgtagcagaggataagaaaatgacg
aatgaagttcaacttgaaatcagcgaatgtggtgttatgagtgttccaaatgtagatgcc
aaaaatggcattccagaagaaactcagcctataattcccaatacctccagcgagaaacct
gaagaggtaaaagcaccctcacctaagccagaagcaagtagcgaagcgccgttggtgtgt
gtcactgtttccaccgacatttctgccgatttaaacggaaagactttagttaattgttca
ccatctgtcgatgtcaaaacaggagactctgttgaagtcaaaacgacaattaccgttaac
gaaaaccctactattactactggtactactagttcggataccgatagtaatcctcctgca
tctcatcttacttcatcggcccgcaataaaatcccttcttctactggccacaaaactcta
aaaccaccatcttcttcatggaaccaaaatgtgaacagagtaggaaccaagagaccatct
agttcagtagcatgcaatgatggtggtagcctaaacttggctaacgcagagcaaacgctt
ccaactccctccaaaagggcaacaccttcaagtccattaaaaactcctcgattcttcaaa
gtgcgcaacgcttcgcaacctaccgacactaacggagggacttgcaaagctacaggaacg
tctatcgcatccgtcactgaatcacctgtccaagaggtggccgtcaacttgaccaaagca
tccagtagtcctaagaagccaactgataaagaaaggtcgtcgagagaaggtaaagaagga
aaagctccatctccccgaccagatattggaagtaatccaattcgcccttactctgttcct
gtcccttcccaatcgaaaaggcaaccatcccctaatttagcagccgaggatgctgctgct
cgattgaggcatctattaaatcctatttcttcagcggcttctacaacaacatcaccatct
tcgggtgacagctctgtccagcagctcagatttccagctgcagcttggctgaatctggcg
agaggagtgccaaatcgccctgttccacttgcattaggacctggctccccatttaataat
cgacctccactttcaccagctcatttcatatccagctttatagcatctcaccctcactac
ccgtatctttctcccatggggcttcctcctgctccggatagtaaaaaatccctcccctct
tccacggcgtcgtcttcgtcgtcttctatcccatctccacaaatgcacaaatccatcagt
ccaaggacatcgaatagctttcctacaccaactttcaacttgaacacgttgcaacaatgc
acttacccatctagcctgtctccgttgctaccgaatcttcctcgtgaattggttggatct
ttctaccattcatcttacgtcccgcgacctttcatgtccgctcgcggtggcccgctttct
gtttccccaaaatctgtttcctcgtcctcatctgttggtagcaatagtagtggcggagga
tttcatccgtcgatgcctcccacggtgacgacgaccacatccaacagctcctcttcggca
gcgggaaggaaatcttctccaggtttgcgacctactgtgcctcgacgaaatgttgcccca
cctcctcctttggtacccatcgggactccaagttccgtacgttcaccacctacgcttctc
ccaattaaagacatagttgagaaagaatcattgtgtgcaaaatcgacctcgcctgcagct
tcaaactgcacgtccgtcgtggaaagttgtgtccctcagatggaggaggaaatcgtcaaa
agcggcccagtttctaaatccaccgatggcaaacctgttgattctacgagtgagaatcaa
cattctcctgcgaaagaaaatggtaaagttatcggggatgcggacagtggtaaagccgac
actcctgcagcgtcaccattagagtgttcgattaacaagacaacaacggataatgccaat
gtggtactcgaaaataaatccgagtcaaaggtggaaattgctgcaccggctccatcttaa

DBGET integrated database retrieval system