KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_31218Help
Entry
DAPPUDRAFT_31218  CDS       T04347                                 

Definition
(GenBank) hypothetical protein
  KO
K03511  DNA polymerase kappa [EC:2.7.7.7]
Organism
dpx  Daphnia pulex (common water flea)
Pathway
dpx03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:dpx00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    DAPPUDRAFT_31218
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dpx03400]
    DAPPUDRAFT_31218
Enzymes [BR:dpx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     DAPPUDRAFT_31218
DNA repair and recombination proteins [BR:dpx03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    DAPPUDRAFT_31218
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IMS IMS_C IMS_HHH Sec34
Motif
Other DBs
NCBI-ProteinID: EFX71523
JGI: Dappu1_31218
UniProt: E9H9L6
LinkDB All DBs
Position
Unknown
AA seq 429 aa AA seqDB search
DDGARKCNSSHENLSIMKLNDHKAGMQGLDTAKINQIIEEASKGSQFYQHKQKNQERIDA
KIANLKAACAKLTEEQKKMARAKMDSLAQKLELTRDLSRTMVHVDMDAFYAAVEMRDCPE
LKTKPMAVGSSSMLTTSNYLARRFGVRAAMPGFIAKKLCPELVIVPTNFPKYTEVSRQVQ
KVFADYDPEFSAASLDEAYLDLTDFLCARKESGAEMTASEAVEEMRAKILESTQLTASAG
IAPNGMLAKVCSDKNKPNGQFILGNSKEAVDEFIKDLPIRKISGIGNVTEQLLGSLGIST
CRDLWNQRELLYLLFSESSYDYFLRVALGIGSGGGGGDGSERERKSVSCETTFRSTSDRN
ELCDIIRQLSADLARDLERHGRLGRSVTLKYKTDKFDVKTRITQLTGYTGDGEVMAKAAT
SLLPSGLNL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
gacgatggtgcacgaaaatgtaattcatcccacgagaacttgagtatcatgaaattgaac
gatcacaaagctggaatgcaaggattggatacggctaaaattaatcaaatcattgaagag
gcttccaaaggttctcaattttaccagcacaagcagaaaaatcaagaaagaattgatgcc
aagattgctaatttgaaggcagcttgtgccaaattgactgaagagcagaagaaaatggcc
agagccaaaatggacagtctggctcaaaaacttgagctgacgagggatttgtctcgcaca
atggtgcatgtggacatggatgccttctatgctgctgtggaaatgagagattgcccagaa
ttgaaaactaaacccatggcagttggctcttcatccatgctgactacatccaactatctg
gccagaagatttggggtcagagcagccatgcctggattcatagccaaaaaattatgccct
gagctggtgattgtccccaccaatttcccaaagtacacggaagtgagtcgccaagtgcaa
aaagtgtttgccgattacgaccccgagtttagcgccgcttcgctggacgaagcttatttg
gacctgacggactttctctgcgctcgtaaagagtctggtgccgagatgacggcctcggaa
gctgttgaggagatgagggccaagatcttggaatcgacccaattaacggccagcgctggc
atcgcacccaacggaatgctggccaaagtgtgctcggacaagaacaagcccaacggccaa
ttcattttggggaacagcaaagaggcggtcgacgagttcatcaaggacttgcccatccgc
aagatcagcggcattggcaacgtgacggagcagctcttgggctcgttgggcatctccacg
tgtcgagatttgtggaatcaacgggaattgctttaccttttgttcagcgagtccagttac
gactatttcctgcgggtcgctctgggaatcggttccggtggtggtggcggcgatggatcc
gaacgtgaacgtaaatcggtgagctgcgagacgacgttccggtcgaccagcgaccgtaac
gaattgtgcgacattatccgtcaattgagcgccgatttggcccgagacctggaacgtcac
ggtcggctcggtcgatcggtgacgttgaaatacaagacggacaagtttgacgtgaagacg
cggatcacgcagttgacgggctacacgggagatggcgaggtgatggccaaggcggccacc
agtttgctgccgtccgggttgaacttg

DBGET integrated database retrieval system