KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_313514Help
Entry
DAPPUDRAFT_313514 CDS       T04347                                 

Definition
(GenBank) hypothetical protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
dpx  Daphnia pulex (common water flea)
Pathway
dpx04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:dpx00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    DAPPUDRAFT_313514
Enzymes [BR:dpx01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     DAPPUDRAFT_313514
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: EFX86010
JGI: Dappu1_313514
UniProt: E9G3C5
LinkDB All DBs
Position
Unknown
AA seq 177 aa AA seqDB search
MQIASTPVIILAVLLIALIRLCNAETGRAHLAGNSPVKGVLNFTECSGELRIVGEITGLT
PGQHGFHVHEFGDIFSNRCDSTGKHFNPTKALHGAPRDAPDLRHAGDYGNILADASGVAK
VDMVDTMTALSGPNSIIGRAMVVHANEDDLGRQNNEGSRTTGNSGPRIACGIIFIAP
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatcgccagcacacctgtaataattttggcggttcttttgattgcgttgattcgg
ttgtgcaatgcggagacgggcagagctcacctggctggaaattcgcccgtcaaaggtgtt
ctcaacttcaccgagtgctcgggtgagttgaggatcgtcggtgagatcacgggattgacg
ccgggccagcacggctttcacgttcacgaattcggcgacatcttcagcaacaggtgcgac
tcgactggcaaacatttcaacccgaccaaggcgcttcacggagctcccagggacgctccc
gaccttcgtcacgccggcgattacggcaacattttggccgatgcctcgggagtggctaag
gtcgacatggtggacacgatgacggcgctgagcggaccgaattccatcatcggacgggcc
atggtcgttcacgccaacgaagacgatctcggccgtcaaaacaacgaaggcagccggacg
acgggcaattccggaccccgcatcgcttgcggcatcatcttcatcgccccctga

DBGET integrated database retrieval system