KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_318250Help
Entry
DAPPUDRAFT_318250 CDS       T04347                                 

Definition
(GenBank) hypothetical protein
  KO
K00310  pyrimidodiazepine synthase [EC:1.5.4.1]
Organism
dpx  Daphnia pulex (common water flea)
Pathway
dpx00480  Glutathione metabolism
dpx00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:dpx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DAPPUDRAFT_318250
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DAPPUDRAFT_318250
Enzymes [BR:dpx01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.4  With a disulfide as acceptor
    1.5.4.1  pyrimidodiazepine synthase
     DAPPUDRAFT_318250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_C_3 Glutaredoxin GST_N_4
Motif
Other DBs
NCBI-ProteinID: EFX80638
JGI: Dappu1_318250
UniProt: E9GI93
LinkDB All DBs
Position
Unknown
AA seq 254 aa AA seqDB search
MSGVFFPISETKHLAPGSTCPEVTPGLMRLYNMKFCPYAQRTRLVLAAKRIPNEVVNINL
VAKPDWYFARNPLGKVPCLEFDGKVIFESLITCDYLDEVYPSSPMLNSTDPFRKAQDRIL
IEMFNAVNSNLYKLYRCSLDDESTWKGAIVGIHKGLQIFEDDLAKREIQFFGGQNPGIVD
YMIWPWMERLPSLPILSHEMLKVQMENYPSLVKWFDAMKEDDAVKESFISPENHAKFITS
FLAGNPEYDMEINK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgagtggagtattttttcctatttctgaaaccaaacatcttgctccaggctcaacatgt
cctgaagtaacaccaggtctgatgcgattgtataatatgaaattctgcccgtatgctcag
cggactagactagttttagctgccaaaagaattccaaatgaggttgtaaatataaacttg
gttgcaaagcctgattggtattttgctagaaatccacttggcaaagttccttgcttggaa
tttgatgggaaagtgatatttgaaagtttaatcacttgcgactatcttgatgaagtgtat
cctagttcaccaatgctgaacagtactgatccttttcgcaaggcgcaagacaggattttg
attgaaatgttcaatgcggtcaatagtaacttatataaactataccgctgtagtttggat
gatgagtccacttggaaaggagctattgttggtatccacaagggtttacagatttttgaa
gatgacctagcaaaacgagaaatacaattttttggaggtcagaatcctgggattgtagat
tacatgatatggccttggatggagagattgccttcattgcctattttgagccatgagatg
ctaaaagttcagatggaaaattatccttctttggtaaagtggtttgatgccatgaaagaa
gacgatgcggtcaaagaaagtttcatttctcctgaaaatcacgcaaaatttattacaagt
tttctagctgggaatccggaatatgacatggaaatcaataaataa

DBGET integrated database retrieval system