KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_318471Help
Entry
DAPPUDRAFT_318471 CDS       T04347                                 

Definition
(GenBank) hypothetical protein
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
dpx  Daphnia pulex (common water flea)
Pathway
dpx00052  Galactose metabolism
dpx00500  Starch and sucrose metabolism
dpx01100  Metabolic pathways
dpx04142  Lysosome
Brite
KEGG Orthology (KO) [BR:dpx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    DAPPUDRAFT_318471
   00500 Starch and sucrose metabolism
    DAPPUDRAFT_318471
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    DAPPUDRAFT_318471
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dpx04147]
    DAPPUDRAFT_318471
Enzymes [BR:dpx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     DAPPUDRAFT_318471
Exosome [BR:dpx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DAPPUDRAFT_318471
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 N6_N4_Mtase tRNA_synt_1c_R2
Motif
Other DBs
NCBI-ProteinID: EFX80346
JGI: Dappu1_318471
UniProt: E9GIY3
LinkDB All DBs
Position
Unknown
AA seq 957 aa AA seqDB search
MAFWKEWKEVIWFSPKDEEDASAQQPKNKKKKKKKARNANREEDDETMDDNSTQINMTWK
DFLLLDNRMRIVYVVLLCLLLGLILPIIISYYLGEYQADLGNCNTPTLNRFECMSGSNVQ
LSKSACESAGCCWNSGSGTPKCYHSNPTRYTYKVDRVVEALDYKMVVDVSPERRSSDMFG
NVMPTARIVVRAVNRDHLVVQMIAPGQLEDDSFRLVTADERTPFSQTDFQVSVTTEKKTS
FAIVVRRASTGEVLLDTSYGPLAISDEYVEMSTTVPSEFIYGLGQGERRQSFKRNFANYG
KTALYNRQKADSYHPLFMSVSPTSGLFHGVFWDNPFPVEIQFSPIPAVSFRSMGGSGVLH
ILAGPTPAAVSLQYRRDIIGLPSPMPPFWSLGFHLCRENDDPETSQNTIREMVNSGIGFD
SDCIDLRLSGPGMGSADLGRFPLAAEHRERLRDQGKKFILSQPPHVQDVEQFPGASWILH
NRTVNSSTIDDYETGVRLDSTVYYPSYPFTGQLTDRWDAMLQPEGFNFLDNWPSNDAKTA
CASTDRPRSFIPEALRSGITNNSICLDAFHPTQELEHLAVHNHYGIQHLQSFVDQAYSYR
FLYLNRAAALGNLGHAGSPGDDLTANWASMKMALVQVMEMGLFGVPLSGSPICGTYNSSL
LTDNLSEVKEEQLCIRWYQMGMMLPFAHSMTKLNQRARSPVDWSLNTRRLVAGYIQQRYR
LLPYFYSLFYQANTQGTPVVRPMWYQFPKDNETYTLNEQFMIGESLMVCPVMVQDDTETN
TAITVYFPSGTWYDYYNGDCVHSGQGDSSVVTTGLNHLNMFVVNSSVFVTQEPGASAEKT
RRNPYTVTTAFPISSTASGWLYVDDGMAADQSAHDLIQFTFTSDGTFTMERVHFGFLGSE
EISTTVNTLRIFGLELKSEQIPAEATYNPYTKVLEFNQLNYDWHQNDFYSLNFIINS
NT seq 2874 nt NT seq  +upstreamnt  +downstreamnt
atggcgttttggaaagagtggaaggaagtcatctggttcagtccaaaagacgaagaggat
gcatctgcccagcagccaaagaacaagaagaagaagaagaagaaggctaggaatgctaat
cgggaagaagatgatgaaaccatggacgacaattctactcaaataaacatgacgtggaag
gattttttgctgctggataatcggatgcgcatagtctacgtcgtccttctctgcctcctg
ctgggccttatcttgcccatcatcatcagttactacctgggcgagtaccaagccgatttg
ggtaattgcaacaccccgacgctaaacaggttcgagtgcatgtcgggatcgaatgtgcag
ctgagcaaatcggcttgcgaatcggccggatgctgctggaattccggaagcggaacgccg
aaatgttaccacagtaatccgacgaggtacacgtacaaggtggacagggttgtggaagcg
ctggattacaagatggtggtggatgtgagcccggagcgtcgatcctccgacatgttcggc
aacgtcatgccgacggccagaattgtcgtcagggccgtcaaccgcgatcatctcgtcgtc
cagatgatcgcacccggccaattggaagacgattccttccggctggtgacggcagacgag
cggacgccattcagccaaacggatttccaagtcagcgtcaccaccgagaagaaaacttct
ttcgccatcgtcgtcagacgggccagcacgggcgaggtgctcctcgacacgtcctacggt
ccgttggccatcagcgacgagtacgtggaaatgtcgacgaccgtgcccagtgaattcatt
tacgggctgggccagggagagcggcgccagtcgttcaagcggaatttcgccaattacggg
aaaacggccctgtacaaccggcagaaagccgatagctaccacccacttttcatgtccgtc
tctcctaccagcggactctttcacggcgtcttttgggacaatccttttcccgttgaaatc
cagttctcgcccattcccgccgtttccttccgctccatgggcggcagcggagtgcttcac
attctggccggacccactccggccgctgtttccctacagtacaggcgtgacattatcggc
ttgcccagtcccatgccgccgttctggtcattgggattccacctgtgtcgggagaacgac
gatcccgagaccagtcagaacaccatcagggaaatggtcaactccggcatcgggttcgat
tccgattgcatcgatttgcggttgtccgggcccggaatgggctccgccgacctgggacga
ttcccgctggcagcggaacatcgtgagcggctccgtgatcaaggcaagaagttcatcctg
tcgcaaccgccccacgtccaggacgtcgagcagttcccaggcgcttcgtggatcctccac
aatcggacggtcaacagttcgacgatcgacgactacgagacgggcgtccgtttggattcg
accgtctactatccgagttatcctttcaccggtcaactgacggacagatgggacgccatg
ctccagccggaaggcttcaattttctggacaattggccgtcaaacgacgccaaaacggca
tgcgcctccaccgaccgtccgagatctttcattcccgaagcccttcgctccggcatcacc
aacaactcgatttgcctggacgctttccaccccacccaggagctggaacacttggcagtt
cacaatcattacggcatccagcacctccagtccttcgtggatcaagcctacagttaccgg
ttcttgtacttgaatcgagcggccgctttaggcaatttgggacacgcaggatcccccggt
gacgacttaaccgccaattgggcatccatgaaaatggctctcgtccaggttatggaaatg
ggactgtttggagtaccgttgtccggctctcccatttgcggcacatacaacagcagtctg
ctcaccgacaatttgtcggaagtgaaggaggaacaactgtgcatccggtggtatcaaatg
ggaatgatgttaccgtttgcccattcaatgaccaagttaaatcaacgggctcgttcccct
gtcgactggtccctaaacacccgcaggctcgtggccggatacatccagcagcgctacaga
ttgttgccctatttctactctcttttctaccaggccaacacccaaggaacaccagttgtg
cggccgatgtggtaccaattcccaaaggacaatgaaacgtacacgctgaacgaacagttt
atgatcggcgagagtcttatggtctgcccggtcatggtccaagacgatacagagaccaac
accgccatcaccgtttacttcccatccggaacttggtacgattattacaatggagactgc
gttcattccggtcaaggagatagttccgtcgtcacgaccggactcaatcatctcaacatg
tttgtcgtcaacagttccgttttcgttactcaggaaccgggagcctctgccgagaaaacg
cgtaggaatccctacacggtcacgaccgcctttccaatctcctccaccgcttccggatgg
ctctacgtcgacgacggaatggcggccgaccaatctgctcacgatttgattcaattcact
tttaccagcgacggaacttttacgatggagcgagttcatttcggattcctgggatcggag
gaaatttcaacgaccgtcaacacccttcgcatatttgggttggaattaaaaagtgaacaa
atccctgccgaagccacttacaatccttacaccaaagtcctcgaattcaaccagctcaac
tacgactggcatcaaaatgacttttacagtttgaatttcattatcaattcgtaa

DBGET integrated database retrieval system