KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_319998Help
Entry
DAPPUDRAFT_319998 CDS       T04347                                 

Definition
(GenBank) hypothetical protein
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
dpx  Daphnia pulex (common water flea)
Pathway
dpx04140  Autophagy - animal
dpx04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:dpx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    DAPPUDRAFT_319998
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    DAPPUDRAFT_319998
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dpx01001]
    DAPPUDRAFT_319998
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dpx03019]
    DAPPUDRAFT_319998
   03036 Chromosome and associated proteins [BR:dpx03036]
    DAPPUDRAFT_319998
Enzymes [BR:dpx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     DAPPUDRAFT_319998
Protein kinases [BR:dpx01001]
 Serine/threonine kinases: AGC group
  PKA family
   DAPPUDRAFT_319998
Messenger RNA biogenesis [BR:dpx03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     DAPPUDRAFT_319998
Chromosome and associated proteins [BR:dpx03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    DAPPUDRAFT_319998
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Bac_GDH
Motif
Other DBs
NCBI-ProteinID: EFX78769
JGI: Dappu1_319998
UniProt: E9GNI4
LinkDB All DBs
Position
Unknown
AA seq 351 aa AA seqDB search
MGNAATTKKGDPTENVEEFLREAKEKFEEQWKNQSQNTACLDDFDRIKTLGTGSFGRVML
VQHKSTKKYYAMKILDKQKVVKLKQVEHTLNEKRILQAISFPFLVSLEYHFKDNSNLYMV
LEYVPGGEMFSHLRKIGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENLLIDSHGY
LKVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRYLLQVDLTKRFGNLKNGVNDIKNHRWFQS
TDWIAIYQKKVEAPFIPKCKGPGDTSNFDDYEEEALRISSTEKCAKEFAEF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatgcagccacaacgaaaaaaggcgatcccactgaaaatgttgaagaattctta
cgtgaggccaaggagaagtttgaagaacaatggaaaaaccaatctcaaaatacggcgtgc
ttagatgacttcgaccgaatcaagaccttgggaacgggctcgtttggtcgcgttatgctc
gtccaacacaaatcgaccaaaaagtactatgccatgaaaattcttgacaaacaaaaggtg
gtaaaactaaagcaggtggaacacacgctaaatgaaaaaagaatcttgcaagcaattagt
tttcctttccttgtcagcttagaatatcacttcaaggacaattctaatttgtatatggtt
ctcgagtacgtccctggcggcgaaatgttttctcacctgagaaaaattggacgattcagc
gaaccacactcgcggttttatgcagcccaaatcgttttggcctttgaatatctccactac
ctggaccttatatacagggatttgaaaccagaaaatcttcttattgacagtcatggatat
ctaaaggtgacagactttgggtttgctaaaagagttaagggacggacatggacgctgtgt
ggaactcccgagtaccttgcccctgaaatcattctcagcaaaggttacaacaaagctgtt
gactggtgggcacttggtgtgttggtttacgagatggctgctggctatcctccctttttt
gccgatcaacctattcagatatatgagaaaattgtctcagggaaggttcgatttccgtcg
catttcagttcagatctgaaggatttactgcgctacttgctacaagttgatctgacgaag
cgttttggtaatctaaagaatggagtaaatgacataaagaatcatcgttggttccagtca
actgactggattgctatctatcagaaaaaggttgaagcgcctttcatccccaaatgtaaa
ggaccaggtgacacaagtaacttcgacgattacgaagaagaagcactaaggatttcgtct
acagaaaaatgtgctaaagaatttgccgagttctag

DBGET integrated database retrieval system