KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_323605Help
Entry
DAPPUDRAFT_323605 CDS       T04347                                 

Definition
(GenBank) hypothetical protein
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
dpx  Daphnia pulex (common water flea)
Pathway
dpx03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:dpx00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    DAPPUDRAFT_323605
Enzymes [BR:dpx01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     DAPPUDRAFT_323605
DNA repair and recombination proteins [BR:dpx03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     DAPPUDRAFT_323605
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase BRCT BRCT_2 PTCB-BRCT mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: EFX75195
JGI: Dappu1_323605
UniProt: E9GZ96
LinkDB All DBs
Position
Unknown
AA seq 845 aa AA seqDB search
MYSVMCLLLPHLDRSRGAYGIKEASLAKLYINIFSLPKDGVDAIRLLKYKVPKTTQRIAK
DFSDVCYDILKDRCGSSISSGTIADINLFLDNLSKTSSKKTENTERILKPILMKLSALEQ
KWLIRVILRNVKLTGMSEKAVLSTYHPDAKELYDVSNDLEKVCATLIDPLNRTSGIEISL
FNPFRPMLADRLSISKILTKMNNKPFYVETKLDGERTQIHKRGKRYGFYTRRGFDYTSSY
GTDSSTGNFTPRLHDCFPESVTSCILDGEMVAWNVNGSFIVSKGANTDVKSMSPTGELVP
CFVAFDILLLNDEVLSNLPYKERLKFLESTVKVKESVLHFPNRKLVSTKAEVENLLNEAI
DQREEGIVLKSPDSIYKPNERKGGWVKVKPEYVGDMMDHLDVIILGGYHGQGRRRNLISM
FLLGLAVPSIEGNQLEFYSFARVGSGFSDEQLMGLLGKLDPYWQKWDKNAPPPMIHFGRE
KPDVWINPSSSAILEIKASEIVLSNSYKAGMTLRFPRVQRIREDRAWDSCMTLSEVIEMR
KYASGKLATRHCSFTEDTPASKRIKLAGLTAVVAAPFQSADTSDVKKSSSCFSKKEICVL
NGSDSLTKQELERKVVSGGGTVVQNPGHVTFCIVAFKDDMRVKSLKNRPKWDIVRPPWLL
RCLNFDRLVPFRPEDLMIATRATEEKMMQNYDKFGNSLREPTSVEDVALILQRVQDLEHP
TPLSMYEIANLEYEIFGQLPKYGIFRTCVVYVDLFETISDPNSQVISRELEIISFDLRIY
GAQVFNRMDSSVTHVVCDPVSYPHRAIDWKTTNHQREVKFKLVRLEWVEHSINKGSLVDE
MQYYP
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
atgtactctgtgatgtgccttctccttcctcatctcgatcgttcaagaggagcatatggt
attaaagaggcatctttagcaaaattatacataaacatatttagtcttccaaaggatggg
gtggatgcgattagattgctaaaatacaaagttcccaagacaacccaaagaattgccaaa
gatttttctgatgtctgttatgacattctaaaggatcgttgtggttcaagtattagttct
gggactattgctgacatcaatctgtttttggacaatttgtcaaagacatcatcaaaaaag
acagaaaatacagaaagaattctcaagccaattttgatgaagttatctgctctagaacaa
aagtggctaattagagtaattcttaggaatgttaaattgactgggatgagtgaaaaggct
gtcctatctacctatcatccagatgctaaagaattgtatgatgtatctaatgaccttgag
aaagtctgtgcaacattgatcgacccgttaaatagaacttctggaatagaaatttcgctt
tttaatccatttcgtcccatgttagcggatagactttcgatatctaaaattcttacgaaa
atgaacaacaagccgttctacgtcgaaacaaaattagatggagaaaggactcaaattcat
aaacgaggaaaaagatacggtttctatactcgacgtggatttgattacacgtcaagctat
ggaactgattcctcgactggaaactttactccgcgtctacacgactgttttcccgaatct
gtgaccagttgtattctagatggagagatggtggcttggaatgttaacggatcctttatc
gtatctaagggtgcaaatactgatgtcaagtcaatgtctcctacaggagaactagttcca
tgtttcgtcgcctttgatattcttctactgaatgatgaagtcctatctaatctaccatat
aaggagcgattgaaattcttagaatcgacagtaaaggtaaaagaaagcgttcttcatttt
cccaaccgtaagctagtttctaccaaagcggaagtggaaaacctgctcaatgaagcaatc
gatcaacgggaagaaggaatcgttttaaaaagtccagattcaatctacaaaccgaatgaa
cgtaaaggaggatgggtgaaagtcaagccagaatatgtaggcgacatgatggatcattta
gatgtgattattctgggtggttatcacgggcagggaagaagaagaaatctgatttcgatg
tttttgcttggcctggctgttccgtccattgaagggaaccaattggaattttattcgttt
gccagggtaggatcgggattttcggatgaacaactaatgggtttgctcggaaaactggat
ccttattggcaaaagtgggataaaaacgctcctccgccaatgattcactttggaagagaa
aaaccggatgtatggatcaatccgtcgtcatcagcaatacttgagattaaagcatcggaa
attgtcttaagcaattcttataaggctggaatgactttacgatttccgagagtgcagcgt
attcgtgaagaccgagcttgggattcctgtatgactctaagcgaagtaatcgaaatgagg
aaatatgcttcagggaagcttgccactcgacactgtagctttacagaagatacacctgct
agcaaacggattaaattagcaggcttgactgcagtcgttgcagctccattccaatcagca
gatacatctgatgtcaaaaaatcatccagttgtttttctaaaaaagagatttgcgttttg
aatggctctgactctctaacgaaacaggaactagaacgaaaggtagtttcgggaggcggt
actgttgtccagaatccagggcatgtaacgttttgtatcgttgcttttaaagatgatatg
cgggttaaaagtctcaagaatagaccgaaatgggatattgttcgtccaccatggttactt
cgttgcttaaattttgatcgtcttgttcctttccggcctgaagacttaatgatcgccacc
cgagccacggaggaaaaaatgatgcaaaactatgataaatttggcaatagcttgagagaa
cctacttcagttgaagatgttgctttaatccttcagcgtgtccaagatttggaacatcca
acgccattaagcatgtatgaaattgcaaatctggagtatgagatatttggacaactacct
aaatatggtatatttcgaacttgcgtcgtttacgtcgatttatttgagactatatctgat
ccgaacagtcaagtgatttctcgagagctagaaataatttcttttgatcttcgtatctat
ggtgcccaagttttcaatcgcatggactcatctgtcactcacgtagtatgcgatccggtt
tcatatcctcaccgcgcgattgactggaaaacaaccaaccatcagcgggaagtcaagttc
aaattggtccgattagagtgggtcgaacattccataaataaaggaagtttagttgatgaa
atgcaatattatccttga

DBGET integrated database retrieval system