KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_327956Help
Entry
DAPPUDRAFT_327956 CDS       T04347                                 

Definition
(GenBank) hypothetical protein
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
dpx  Daphnia pulex (common water flea)
Brite
KEGG Orthology (KO) [BR:dpx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dpx01001]
    DAPPUDRAFT_327956
Enzymes [BR:dpx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     DAPPUDRAFT_327956
Protein kinases [BR:dpx01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   DAPPUDRAFT_327956
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo RIO1 APH 5_nucleotid Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: EFX70647
JGI: Dappu1_327956
UniProt: E9HCA1
LinkDB All DBs
Position
Unknown
AA seq 380 aa AA seqDB search
MPFFGKRDKDKESSKKSTNLLKKDDKSSPSLEDRYELKDLLGTGAFSQVRLAESKTEAGK
LFAVKIIDKTALKGKEDSLENEIKVLRRLKHPNIVQLLETYEDKSKVYLVMELVTGGELF
DRIVEKGSYTEKDAADLMRQVLEAVDYMHEQGVVHRDLKPENLLYYCPDEDSKIMISDFG
LSKMEDSGIMATACGTPGYVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDESDAN
LFAQILKGEFEFDSPYWDEISDSAKDFIRRLMCVDVNKRFTCREALQHPWISGNAASTKN
IHSSVSEQLKKNFAKSRWRQAYNATAVIRQMRHLVLASTNSRSTLSSGEENNSSSDRELD
DQPPRPKTVTAASANGRPAL
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgcctttttttggtaaacgtgataaagacaaggagtccagcaagaagagcaccaatctc
ttgaaaaaagatgacaaatcctcaccatctctggaggacagatatgaactgaaagatctc
cttggaacgggtgctttctcgcaagtgcggctggccgaatcgaaaacagaagctggcaag
ctgtttgccgtcaaaatcattgacaagacggcgctcaaaggcaaggaagactcgctagag
aacgagatcaaagttctacgaaggctcaagcaccccaatatcgtccagctgctggagaca
tacgaagacaagagcaaagtctacctggtcatggaactagtgacaggtggcgaactcttc
gatcgcatcgtggagaaaggatcgtacacggaaaaggatgcggccgatctgatgcgacaa
gttctcgaggccgtcgactacatgcacgagcaaggagtcgtccatcgcgatctcaagccg
gagaatttgctgtactactgcccggatgaagacagcaagatcatgatcagcgatttcgga
ttgtccaaaatggaagactctggtatcatggcaacggcgtgcgggactcccggctatgtc
gcaccggaagtgttggcccaaaagccctacggcaaagccgtcgatgtctggagcatcgga
gtcatttcctacatcctactgtgcggctatccgcccttttacgacgagagcgacgccaat
ctcttcgcacaaatcttgaaaggtgaattcgagtttgactctccgtattgggacgaaatt
agcgattccgccaaggatttcatccgtcgactcatgtgcgtcgatgtcaacaagcgtttc
acatgccgcgaagccctccaacatccctggatatctggcaatgccgccagcaccaagaac
atccatagttccgtctctgagcaactgaaaaagaactttgccaagtcgcgatggaggcaa
gcgtacaacgccacggccgtcatccgccagatgaggcacttggttttggccagcaccaac
agccggtcgacgttgagcagcggcgaagaaaacaactcttccagcgaccgcgagctcgac
gatcaaccgccccgccccaaaaccgtcaccgccgcctcagccaacggacgtccagccctc
tag

DBGET integrated database retrieval system