KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_330274Help
Entry
DAPPUDRAFT_330274 CDS       T04347                                 

Definition
(GenBank) hypothetical protein
  KO
K07466  replication factor A1
Organism
dpx  Daphnia pulex (common water flea)
Pathway
dpx03030  DNA replication
dpx03420  Nucleotide excision repair
dpx03430  Mismatch repair
dpx03440  Homologous recombination
dpx03460  Fanconi anemia pathway
Module
dpx_M00288  RPA complex
Brite
KEGG Orthology (KO) [BR:dpx00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    DAPPUDRAFT_330274
   03420 Nucleotide excision repair
    DAPPUDRAFT_330274
   03430 Mismatch repair
    DAPPUDRAFT_330274
   03440 Homologous recombination
    DAPPUDRAFT_330274
   03460 Fanconi anemia pathway
    DAPPUDRAFT_330274
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dpx03000]
    DAPPUDRAFT_330274
   03032 DNA replication proteins [BR:dpx03032]
    DAPPUDRAFT_330274
   03400 DNA repair and recombination proteins [BR:dpx03400]
    DAPPUDRAFT_330274
Transcription factors [BR:dpx03000]
 Eukaryotic Type
  Zinc finger
   Other Cys4 zinc finger factors
    DAPPUDRAFT_330274
DNA replication proteins [BR:dpx03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    DAPPUDRAFT_330274
DNA repair and recombination proteins [BR:dpx03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     DAPPUDRAFT_330274
   MMR (mismatch exicision repair)
     DAPPUDRAFT_330274
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     DAPPUDRAFT_330274
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: REPA_OB_2
Motif
Other DBs
NCBI-ProteinID: EFX68248
JGI: Dappu1_330274
UniProt: E9HJ30
LinkDB All DBs
Position
Unknown
AA seq 227 aa AA seqDB search
MDLLGFEPRTNKDIRAPRRSLNPLYHRNMSYIFDLFNVGVILGKPKKLVVGEVTEEAAEK
PTITFNFVPFDQLTNLENISIVDVIGLVLHLQEKVLVETKTTKISRSLTAEFVDSTNTEV
RLHSLFNYRGSLLEKVADKCIVALSGVKISNKFGRRYLETLSSTVVQINPDMTEVRELRE
WTCDFTQKSDAFFKLGNKEFHKANNNGLRPLRMNFDPEICKRLSKIT
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggatctcctaggatttgaaccaaggaccaataaagatattcgagctcctaggcggagt
ctgaacccactgtaccatcggaatatgtcttacattttcgatctcttcaacgtgggagta
attctaggaaagcctaagaaactcgttgttggagaggttactgaagaggcagcagaaaaa
cctacaatcaccttcaactttgttccctttgatcagctaactaacctggaaaatattagt
attgttgatgttattggtttggtattgcatttgcaagaaaaggttttggttgaaacaaag
acaacaaaaatatcgaggtctctaacagctgagtttgtggacagtaccaacacagaggtt
agactacattctttgtttaattatcgaggttcgttattggaaaaagtggcagataaatgc
attgtagcattatctggtgtgaaaatttcgaacaaatttggacgtcgttatctagaaaca
ctctcgtctaccgtcgtgcagattaatcctgacatgactgaagttcgtgaactcagagag
tggacgtgcgattttacacaaaaaagtgatgcatttttcaagctggggaacaaggaattc
cacaaggccaacaacaacggccttaggccgttgagaatgaacttcgaccccgagatctgc
aaaaggctttctaaaatcacctaa

DBGET integrated database retrieval system