KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_331277
Entry
DAPPUDRAFT_331277 CDS       T04347                                 

Definition
(GenBank) hypothetical protein
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
dpx  Daphnia pulex (common water flea)
Pathway
dpx04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:dpx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    DAPPUDRAFT_331277
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-ProteinID: EFX67239
JGI: Dappu1_331277
UniProt: E9HLZ8
LinkDB
Position
Unknown
AA seq 181 aa
MQLVQVQSYGFLPVVGGGGHSSPSSQMAVTVRGRVSPVRRQLFAADPEGDAQELEHRRSV
QRQMDQLQQENSRKWNFDFKNEVPLGGRYVWQSATLPFDRPSHPLPPLTGIKRPIDNQDS
AMAAPLFKQMKHDSINNNHRSANQQTKITDFMKNTKLNETKRHDGGSRPSTSNNNNNGVG
H
NT seq 546 nt   +upstreamnt  +downstreamnt
atgcagctcgttcaagtgcagtcttacggattcctgccagttgtcggtggtggtggccat
tcctcgccgtcctcgcagatggccgttaccgtgcgtgggcgcgtctcacctgtacgacgc
cagttgttcgccgccgatcctgaaggagacgcccaagagctggaacaccggcgatcggtc
cagcgtcagatggatcagctccagcaagagaacagccgcaagtggaattttgatttcaag
aacgaagtgccgctgggtggacgttacgtctggcagtcggcgacgcttccattcgatcgc
ccgtctcaccccctgccgccgctgactggaatcaaacgcccgatcgataatcaagactcg
gccatggctgcaccactcttcaaacaaatgaagcacgattccatcaacaacaatcatcgc
tccgctaaccagcagaccaaaatcacagattttatgaaaaacacgaagctgaacgagacc
aaacgtcacgacggtggatcgcgtccgtcaacttccaacaacaacaacaacggagtgggc
cactaa

DBGET integrated database retrieval system