KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_42792Help
Entry
DAPPUDRAFT_42792  CDS       T04347                                 

Definition
(GenBank) hypothetical protein
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dpx  Daphnia pulex (common water flea)
Pathway
dpx00010  Glycolysis / Gluconeogenesis
dpx00030  Pentose phosphate pathway
dpx00051  Fructose and mannose metabolism
dpx00052  Galactose metabolism
dpx01100  Metabolic pathways
dpx01200  Carbon metabolism
dpx01230  Biosynthesis of amino acids
dpx03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:dpx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DAPPUDRAFT_42792
   00030 Pentose phosphate pathway
    DAPPUDRAFT_42792
   00051 Fructose and mannose metabolism
    DAPPUDRAFT_42792
   00052 Galactose metabolism
    DAPPUDRAFT_42792
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    DAPPUDRAFT_42792
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dpx01009]
    DAPPUDRAFT_42792
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dpx03019]
    DAPPUDRAFT_42792
Enzymes [BR:dpx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     DAPPUDRAFT_42792
Protein phosphatases and associated proteins [BR:dpx01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     DAPPUDRAFT_42792
Messenger RNA biogenesis [BR:dpx03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     DAPPUDRAFT_42792
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: EFX87576
JGI: Dappu1_42792
UniProt: E9FYQ8
LinkDB All DBs
Position
Unknown
AA seq 800 aa AA seqDB search
MEGQKPSANYSEAEAQNLIHGGHYKDKGIAVFTSGGDAQGMNAAVRAVVRMGIYVGAKVY
FIKEGYQGMVDGGDNIVEANWSSVSGIIHKGGTIIGSSRCKEFRERPGRLRAAKNLILKG
ISNLVVIGGDGSLTGANLFRQDWPELVTELAAKGDITLEQAKKFAHLNIVGMVGSIDNDF
CGTDMTIGTDSALHRIIEAVDAIAATAYSHQRTFIMEVMGRHCGYLAVVTALTTEADYVF
YPENPPPVDWPDKICKKLSQERESGQRLNIIIVSEGAIDREGNPITAEMIRKVVVDNLQQ
DTRITVLGHVQRGGSPSAFDRVLGCRMGAEAVMAVLEATPETEACVVSLDGNQAVRLPLM
ACVEKTQAVAKAMADKQWELAVQLRGRSFARNVETYKMLTRLKPPKMSPEIALAHGVRIG
YTLGVMHVGAPACGMNAAVRSFVRNCIYRGDTVVGIHDGVEGLIEGNVHPLGWGDVTGWV
GQGGAFLGTKRTLPDGKYPEVAASLRKHKIQALLIIGGFEAYQTVLHLAENRDKYPEFCI
PMAIVPSTISNNVPGTDFTLGADTALNEITEICDRIRQSAQGTKRRVFIIETMGGYCGYL
ATLAGVAGGADAAYIYEEPFNVKNLQMDVEHVASKMAMEGVERGLILRNENANENYTTDF
IYKLFSEEGKGVFSARMNVLGHMQQGGSPTPFDRNMGTKLAAKAVEWMVEQLTQATQPDG
SICANKPESAVMLGIVKRYYAYTPVQELKAETDFKHRLPKTQWWLKMRPLLRILAKHEST
YQEEGAYVAVEEDVDNHIIN
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atggagggacaaaaaccttcggcaaactattccgaggctgaagcccagaatctcatccat
ggaggtcattacaaggacaagggcattgcagtttttactagtggaggagatgcacaaggt
atgaacgctgctgtgagagctgtagtgaggatgggcatttatgtgggtgccaaggtgtat
ttcatcaaagaaggttatcaaggaatggtggatggtggagacaatattgttgaagccaac
tggtcctctgtgtctggaattatccacaagggaggcaccattattgggtcatctcgttgc
aaagagtttcgggagcgccccggtcgtctccgtgccgccaagaaccttattttgaagggc
atctccaatttggttgtcattggtggtgacggctcactaactggagcaaatttattccgg
caagactggcctgaactggtgactgaactggcagccaaaggtgacatcacacttgagcag
gcgaaaaaatttgcgcaccttaatatcgttggtatggttggctcaatcgacaacgacttt
tgcggtaccgacatgacgatcggtactgactctgccttgcatcgtattatcgaagccgtt
gacgcaatcgcagcgacagcttattctcaccagagaacattcatcatggaggttatgggt
cgtcattgcgggtatttagccgtagtgactgctttaaccaccgaggcagattacgtgttc
tatcctgaaaatccgccaccagtcgactggcctgacaaaatttgcaagaaactttctcag
gaacgagaatcgggccagcgcttgaatattattattgtcagtgaaggagctatcgatcgt
gaaggcaacccaatcactgctgaaatgatccgtaaagttgttgtagacaatttgcaacaa
gacacgaggatcactgtcctcggtcacgtccagcgcggtggcagtccatctgctttcgat
cgtgtgctgggttgtcgtatgggagctgaagctgtgatggctgttttggaagccacccct
gaaactgaagcttgcgttgtgtcattggatggcaatcaagctgtcagactgcctttaatg
gcatgcgtcgagaagactcaggctgtcgcgaaagccatggctgataaacagtgggaatta
gctgttcagcttcgtggcaggagttttgcccgcaacgttgagacctacaagatgctcacg
cgtctgaagccgcccaagatgtccccggaaatagccttagcacacggagtaagaatcggc
tatactttgggagtgatgcatgttggagccccagcatgtggaatgaatgctgctgtccga
tctttcgtccgcaactgcatataccgcggcgacactgtcgttggaatccatgatggtgtt
gaaggattgatcgaaggaaatgttcatcccttgggttggggagacgttactggttgggtt
ggacaaggtggagcctttttgggcactaagcgaaccttacccgatggcaagtatcctgaa
gtagccgctagtcttcgaaaacacaaaattcaggctcttcttattattggtggcttcgag
gcatatcaaactgtgcttcacttagccgagaaccgtgataaatatccggaattttgcatt
cccatggctattgttccgtccaccattagtaataatgttccaggaacggacttcactctc
ggcgccgacactgctttgaatgaaattactgagatttgcgatcgcatccgccagtcggcc
caaggaacaaaacgtcgagtatttatcattgagactatgggtggctattgtggatatctc
gctacattggccggtgtggctggaggagctgatgctgcttacatttatgaggaaccattt
aacgtcaagaatttacaaatggacgttgaacatgtggcgtctaaaatggctatggaagga
gttgaacgtggtcttattcttcgaaacgagaacgcaaatgagaattataccacagatttc
atctacaagctattctccgaagaaggcaaaggagttttcagcgccaggatgaacgttctg
ggccatatgcagcaaggtggttcaccaacccctttcgaccgtaacatgggtactaaacta
gccgctaaagctgtcgaatggatggttgaacagctaacccaagctactcagccggacggt
tcgatctgcgccaacaagcctgaatcagccgtcatgcttggtatcgtcaaacgctactac
gcgtacacaccagttcaagaactgaaggccgagactgacttcaagcatcgactaccaaaa
actcaatggtggctgaaaatgcgcccgctgcttcgtattttggccaagcacgaatctact
taccaagaagagggcgcgtacgtcgccgtcgaagaagacgtcgataatcacattattaac
tag

DBGET integrated database retrieval system