KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_442930Help
Entry
DAPPUDRAFT_442930 CDS       T04347                                 

Gene name
RPD3
Definition
(GenBank) putative histone deacetylase Rpd3 protein
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
dpx  Daphnia pulex (common water flea)
Pathway
dpx04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:dpx00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    DAPPUDRAFT_442930 (RPD3)
Enzymes [BR:dpx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     DAPPUDRAFT_442930 (RPD3)
Chromosome and associated proteins [BR:dpx03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     DAPPUDRAFT_442930 (RPD3)
   HDAC complexes
    Sin3A-HDAC complex
     DAPPUDRAFT_442930 (RPD3)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    DAPPUDRAFT_442930 (RPD3)
  Chromatin remodeling factors
   NuRD complex
    DAPPUDRAFT_442930 (RPD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-ProteinID: EFX74892
JGI: Dappu1_442930
UniProt: E9GZX2
LinkDB All DBs
Position
Unknown
AA seq 538 aa AA seqDB search
MTTQPSHSRKRVCYYYDSDIGNFYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKFHSDDYIRFLRSIRPDNMTEYNKQMQRFNVGEDCPVFDGLYEFCQLSAGGSVA
GAVKLNKQATEIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPLRDGIDDESYEQ
IFVPIMSKVMETYQPSAVVLQCGADSLSGDRLGCFNLTLKGHAKCVDFVKKHNLPLLLLG
GGGYTIRNVARCWTYETAVALGNDIANELPYNDYFEYFGPDFKLHISPSNMANQNTPEYL
DKIKTRLFENLRMLPHAPGVQMQAIPEDAINEDSDEEDKSNPDERISIRASDKRIAPDNE
YSDSEDEGDSRRDQRSFKGANRKRPRTETAEGAAEVKKEEKEDKEVNGENKEGTSKETVK
DSDKKNETTLKSSGESSSEGSALSMANEIKEPEEDKSTSHELSSPVPVCADSSKGEKV
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgactactcaaccaagtcacagcagaaagcgagtttgctactattatgacagtgacatt
gggaatttttattatggacagggacatcccatgaaacctcatcgcatacgcatgacccac
aacttgctcttgaattatgggctataccgtaaaatggaaatatatcgaccacacaaagcc
acagctgaagaaatgaccaagttccacagtgatgattacattcgatttcttcgcagcatc
agacctgacaatatgactgaatacaataaacagatgcagagatttaatgtgggtgaagac
tgtcctgtttttgatgggctctacgaattttgtcaattatctgctggaggttctgtagct
ggagctgtgaagctcaacaagcaagcaactgagatagctgtgaactgggctgggggattg
catcatgccaaaaagtctgaggcatcaggattctgctatgtaaatgacatagtgttggca
attttagagcttctgaaataccaccaacgtgttttgtatattgacattgatattcatcat
ggtgatggagtggaagaagccttttacactactgatcgtgtaatgactgtttcatttcac
aaatatggagaatattttcctggaactggagatctcagagacattggtgcaggcaaagga
aaatattatgccgtaaatttccccctgagagatggaatagatgatgaaagctatgagcaa
atcttcgtacctatcatgtcaaaagtgatggaaacttatcagccgagtgcagtggttctc
caatgcggtgccgatagtttgtctggtgatcgtttgggatgctttaatcttactttgaaa
ggtcacgcaaaatgtgttgattttgttaagaaacataatctgcctttactgctgcttgga
ggtggtggttacactattcgaaatgttgcccgttgttggacttacgagaccgcagtggca
ctgggaaatgacattgcaaatgaactcccttacaacgattattttgaatattttggtccc
gattttaaattgcacattagtccgtctaacatggcaaatcaaaatactccggaatattta
gataaaatcaaaactcgtcttttcgaaaacctccgcatgttacctcatgctcctggagtc
caaatgcaagcaattcccgaggatgccattaacgaagattccgacgaagaagataaatct
aatcccgatgaacgtatatctatacgagcatcagataaaagaattgcaccagacaatgaa
tacagtgattccgaagatgaaggggattcccgccgagatcaaagatcatttaaaggagca
aatcgcaaaagaccaagaaccgaaacagctgagggtgctgcagaggtcaaaaaggaagaa
aaggaggacaaagaagtgaatggcgagaataaggaaggtacttcgaaagagacagtaaag
gattcggacaagaaaaatgagacaacactgaagtctagtggtgaatcttctagtgaaggc
agtgctttgtccatggcgaatgaaataaaagaacctgaagaagataaatctacatcgcat
gaattaagctcccctgttccggtttgcgccgatagcagtaaaggagaaaaagtttga

DBGET integrated database retrieval system