KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_49762Help
Entry
DAPPUDRAFT_49762  CDS       T04347                                 

Definition
(GenBank) phosphatase and tensin-like protein
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
dpx  Daphnia pulex (common water flea)
Pathway
dpx00562  Inositol phosphate metabolism
dpx01100  Metabolic pathways
dpx04068  FoxO signaling pathway
dpx04070  Phosphatidylinositol signaling system
dpx04140  Autophagy - animal
dpx04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:dpx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    DAPPUDRAFT_49762
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    DAPPUDRAFT_49762
   04070 Phosphatidylinositol signaling system
    DAPPUDRAFT_49762
   04150 mTOR signaling pathway
    DAPPUDRAFT_49762
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    DAPPUDRAFT_49762
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dpx01009]
    DAPPUDRAFT_49762
Enzymes [BR:dpx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     DAPPUDRAFT_49762
    3.1.3.48  protein-tyrosine-phosphatase
     DAPPUDRAFT_49762
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     DAPPUDRAFT_49762
Protein phosphatases and associated proteins [BR:dpx01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    DAPPUDRAFT_49762
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase3 PTPlike_phytase Y_phosphatase DSPn Y_phosphatase2 CDKN3
Motif
Other DBs
NCBI-ProteinID: EFX81708
JGI: Dappu1_49762
UniProt: E9GFW2
LinkDB All DBs
Position
Unknown
AA seq 280 aa AA seqDB search
MASTIKGLVSRKKKRYKEDGFNLDLTYIFDNVIAMGYPAAKLEGVYRNHIDDVYKFLETK
HKDHYKIYNLCSERSYDYSRFNNRVSSFPFDDHNPPKLGLIEPFCKDMDEWLNQDQSNVA
AIHCKAGKGRTGLMICCYILHRGWAENADDALKHYGQTRTHDTKGVTIPSQRRYVEYYDQ
LLKEGGSGYSLCPLELREIRLQPIPNMSGGCVPVLTIFEAESQQEFNPPIELTKVGRVLR
ITLKTPLSLKGDVRVILKNKPNVIMLKEKMFHFWFNTYFV
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcactatcaaaggattggttagtcgcaagaagaagcgctataaggaagatgga
tttaatctagacttgacttatatatttgacaatgtcattgccatgggatatccagctgcc
aagctagaaggagtctatcgaaatcacattgatgatgtgtataagtttttggaaacaaaa
cataaagatcactacaagatatacaacttgtgttcagagcgttcctatgactacagtaga
ttcaacaatcgagtttcttccttcccatttgatgatcacaaccctcctaaactggggtta
atagagccattctgtaaggacatggatgagtggcttaatcaggatcaatcaaatgttgct
gctattcactgcaaagctggaaaaggaagaaccggtttaatgatatgctgttatatacta
catcgaggatgggccgaaaatgcagatgacgcccttaaacactatgggcagacgagaact
cacgatactaaaggtgtcaccatacctagccagagacgctatgttgagtattacgatcaa
ttactcaaagagggcgggtcgggctattcactgtgccctctcgagttgcgtgaaattcgc
ctgcagcccattcccaatatgagtggtggttgtgttcccgttttgaccatatttgaagcg
gaaagccaacaagaatttaatccaccaattgagctgaccaaagtcggacgcgtgctacgc
attaccttgaaaacaccgctgagcctcaagggcgacgtgcgggtgatcctcaaaaacaaa
cccaacgtgataatgctgaaagagaagatgtttcatttttggttcaacacctatttcgtc

DBGET integrated database retrieval system