KEGG   Diaphorobacter polyhydroxybutyrativorans: BA022_01855Help
Entry
BA022_01855       CDS       T04937                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
dpy  Diaphorobacter polyhydroxybutyrativorans
Brite
KEGG Orthology (KO) [BR:dpy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BA022_01855
Enzymes [BR:dpy01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BA022_01855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 FAD_oxidored GIDA HI0933_like AlaDh_PNT_C Glutaredoxin Thi4 DAO FAD_binding_3 NAD_binding_8 K_oxygenase DSBA Thioredoxin_4
Motif
Other DBs
NCBI-ProteinID: ASI67431
UniProt: A0A2Z2LCG4
LinkDB All DBs
Position
411524..413080
Genome map
AA seq 518 aa AA seqDB search
MLDANLQAQLKAYLERLQRPVELVATLDDGATSQELRELLQEIRSLSDKITVVEKNDAPV
RKPSFLITNPGVDTGVRFAGVPLGHEFTSLVLALLQVGGHPSKESADLLEQVKGLDGDFH
FETYYSLSCHNCPDVVQALNLMSVLNPRITHTAIDGAVFQDEIKERQIMGVPTVFLNGKN
FGQGRMELAEIVAKIDSGAHARVAAKLNAMEPFDVLVVGGGPAGAAAAVYAARKGIRTGV
AAERFGGQVLDTVDIENYISVSKTEGPKFAIALEQHVNDYDVEVMNLQRAKALKPAATEG
GLVEIELDNGATLKSKTVILSTGARWRNMNVPGEEQYRTKGVTYCPHCDGPLFKGKDVAV
IGGGNSGVEAAIDLAGIVKSVTVLEFASELKADGVLQKKLRSLPNVTVILNAQTTEVNGD
GSKVTGLTYKDRTTDEAKTVAVEGIFVQIGLLPNTDWLKGTVDLTRFGEIIIDARGHTNV
PGVFAAGDCTNVPYKQIIIAAGAGATAALSAFDHLIRH
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaacctccaagcccaattgaaagcctatctggagcgcctgcagcgcccg
gtggagctggtcgccacgctggacgatggcgccacttcccaagagctgcgggaactgctc
caggagatccgctccctctccgacaagatcactgtggtcgagaagaacgacgcgcccgtg
cgcaagccgtccttcctgatcactaaccccggcgtggacaccggcgtgcgtttcgcgggc
gtccccctgggccatgagttcacctcgctggtgctggcgctgctgcaggtgggcggccat
ccctccaaggaatcggcggacctgctggagcaggtcaagggcctggacggcgacttccat
ttcgagacgtactactcgctgtcctgccacaactgccccgacgtggtccaggcgctgaac
ctgatgagcgtgctcaacccgcgcatcacgcacacggccatcgacggcgccgtgttccag
gacgagatcaaggaacgccagatcatgggcgtgcccacggtgttcctgaacggcaagaat
ttcggccagggccgcatggagctggcggagatcgtcgccaagatcgacagcggtgcgcat
gcccgcgtggccgccaagctcaacgccatggagccgttcgacgtgctggtggtcggcggt
ggtcccgccggtgccgcggccgccgtgtatgcggcgcgcaagggcattcgtaccggcgtg
gcggccgagcgcttcggcggccaggtgctggataccgtggacatcgagaactacatctcg
gtgagcaagaccgaaggccccaaattcgccatcgcgctggagcagcacgtgaacgactac
gacgtcgaggtgatgaacctgcagcgcgccaaggcgctgaagcccgccgcaacggaaggc
ggcctggtggaaatcgaactcgacaacggcgcaacgctcaagagcaagaccgtgatcctg
tcgaccggcgcgcgttggcgcaacatgaacgtgccgggcgaggagcagtaccgcaccaag
ggcgtgacgtactgcccgcactgcgacggcccgctgttcaagggcaaggacgtggcggtc
atcggcggcggcaactcgggcgtagaggccgcgatcgacctggccggcatcgttaagagc
gtgacggtgctggagttcgccagcgaattgaaggccgatggcgtgctgcagaaaaagctg
cgcagcctgcccaacgtgacggtcatcctgaacgcccagaccacggaagtgaatggcgac
ggcagcaaggtcaccggcctgacctacaaggaccgcacgacggacgaggccaagaccgtg
gcggtcgagggcatcttcgtgcagatcggtctgttgcccaacaccgactggctcaagggc
acggtggacctgacgcgctttggcgagatcatcatcgacgcccggggccacaccaacgtg
ccgggcgtgttcgccgcgggagactgcaccaacgtgccatacaagcagatcatcatcgcc
gcaggggcgggcgcgacggcggccttgtcggccttcgaccacctgattcgccactga

DBGET integrated database retrieval system