KEGG   Diaphorobacter polyhydroxybutyrativorans: BA022_02430Help
Entry
BA022_02430       CDS       T04937                                 

Definition
(GenBank) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
dpy  Diaphorobacter polyhydroxybutyrativorans
Pathway
dpy03030  DNA replication
dpy03410  Base excision repair
dpy03420  Nucleotide excision repair
dpy03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:dpy00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    BA022_02430
   03410 Base excision repair
    BA022_02430
   03420 Nucleotide excision repair
    BA022_02430
   03430 Mismatch repair
    BA022_02430
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dpy03032]
    BA022_02430
   03400 DNA repair and recombination proteins [BR:dpy03400]
    BA022_02430
Enzymes [BR:dpy01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BA022_02430
    6.5.1.6  DNA ligase (ATP or NAD+)
     BA022_02430
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     BA022_02430
DNA replication proteins [BR:dpy03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    BA022_02430
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     BA022_02430
DNA repair and recombination proteins [BR:dpy03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     BA022_02430
   NER (nucleotide excision repair)
    Other NER factors
     BA022_02430
   MMR (mismatch exicision repair)
    Other MMR factors
     BA022_02430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_OB_2 DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: ASI67537
LinkDB All DBs
Position
complement(534888..535877)
Genome map
AA seq 329 aa AA seqDB search
MLPATHFALLALRRRAWVLVVAACVGAANAQPAAALESPSSADPAAPSPTLAQHYHPGVV
VADYWVSEKYDGVRALWTGQQLISRQGLPIRAPAWFTAGWPPVPMDGELWAGRGQFAAAQ
AAVAQATPDDARWRALRYMVFDLPRVPGGFGERLPLLRRTVAHLGQPWVQPAAQWRVSSH
TELMGQLHRLEKAGAEGLMLRRDDAPYRGGRSDDLLKLKTFEDAEAVVVGQEPGRGKYAG
QTGALLVALPDGRRLRLGSGLPDAVRRNPPPAGTVVTYRFNGTHASGLPRFARFWRVRAD
APSAPSAANAAAAGGQANLEPGPARNRGK
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgctccctgcaacgcacttcgcactgttggccctccggcgccgggcctgggtgctggtc
gtcgctgcttgtgtaggagcagcaaacgcgcagccggctgctgccctggagtcgccctcc
tccgcggacccggcggcgccctcgcccacgctggcgcagcattaccacccgggcgtggtg
gtcgcggactattgggtgagcgaaaaatacgacggcgtacgcgccctctggaccggtcag
caactgatcagccggcagggcctgcccatccgggcgccagcgtggttcaccgccggctgg
ccgccggtaccgatggatggcgaactgtgggccggccgcggccagtttgccgccgcgcag
gcggccgtggcgcaggccacgcccgacgatgcccggtggcgcgcgctgcggtacatggtg
ttcgacctgccgcgcgtgccgggcggtttcggcgagcgcctgcccctgctgcgccgcacc
gtggcccatctgggccagccgtgggtccagcctgccgcgcaatggcgggtgtccagccac
acggaattgatggggcagttgcaccggctggagaaggccggcgccgagggactgatgctg
cgccgggacgacgcgccctaccgtggcgggcgcagcgatgatctgctcaagctcaagacc
ttcgaggatgcggaggccgtggtggtagggcaagagcccggacgcggcaaatacgcgggc
cagaccggcgcgctgctggtggcgctgcccgacggccggcgcctgcgcttgggcagcggc
ctgccggatgcggtgcggcgcaatccaccgccggcgggcaccgtggtgacctaccgcttc
aacggcacccacgcaagcggcttgccgcggtttgcgcgcttctggcgagtgcgcgccgac
gcgccctccgcgccctccgcggccaacgcagccgctgccggcgggcaggccaatctggag
cccggcccagcaagaaacagaggcaaatga

DBGET integrated database retrieval system