KEGG   Diaphorobacter polyhydroxybutyrativorans: BA022_05625Help
Entry
BA022_05625       CDS       T04937                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
dpy  Diaphorobacter polyhydroxybutyrativorans
Pathway
dpy00010  Glycolysis / Gluconeogenesis
dpy00620  Pyruvate metabolism
dpy01100  Metabolic pathways
dpy01110  Biosynthesis of secondary metabolites
dpy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dpy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BA022_05625
   00620 Pyruvate metabolism
    BA022_05625
Enzymes [BR:dpy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BA022_05625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: ASI68102
UniProt: A0A2Z2LF95
LinkDB All DBs
Position
1242275..1243798
Genome map
AA seq 507 aa AA seqDB search
MNMAEIASLGIANPYKQQYGNYIGGHWVAPVDGQYFENISPINGQKFTAVPRSNSKDIDA
ALDAAHKAKAAWGRTSTTERANILNRIADRMEANLLQIAVAETIDNGKPLRETMAADIPL
AIDHFRYFAGAVRAQEGGISEIDADTIAYHFHEPLGVVGQIIPWNFPILMAVWKLAPALA
AGNCVVLKPAEQTPASILVLMEIIGDLLPPGVVNVVNGFGLEAGKPLASSNRIAKIAFTG
ETTTGRLIMQYASQNIIPVTLELGGKSPNIFFEDVMSADDGFFDKALEGFAMFALNQGEV
CTCPSRALIQESIYERFMERALKRVAAIQQGHPLDKNTMIGAQASQEQLEKILSYLDLGK
QEGAQCLIGGARNTALGGDLAGGYYVQPTVFKGHNKMRIFQEEIFGPVVSVTTFKTEEEA
LEIANDTLYGLGAGVWSRDGARAFRMGKGIQAGRVWTNCYHHYPAHAAFGGYKQSGIGRE
NHKMMLDHYQQTKNLLVSYTQQPLGFF
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaacatggccgaaatcgccagccttggcatcgccaacccctacaagcagcagtacggc
aactacatcggcgggcactgggtggcgcccgtggacgggcagtacttcgagaacatctcg
cccatcaacggccagaagttcacggccgtgccacgctccaacagcaaggacatcgacgcc
gcactggacgccgcccacaaagccaaggccgcgtggggccgcacctcgaccaccgagcgc
gccaacatcctgaaccggatcgccgaccgcatggaggccaacctgctgcagatcgccgtg
gccgagaccatcgacaacggcaagccgctgcgcgagaccatggcggccgacattccgctg
gccatcgaccacttccgctacttcgccggcgcggtgcgcgcgcaggagggcggcatcagc
gagatcgacgccgacaccatcgcctaccacttccatgagccgctgggcgtggtcgggcag
atcattccgtggaacttccccatcctgatggcggtgtggaaactcgcccccgcgctggct
gcgggcaactgcgtggtgctgaaacccgcggagcagacgcccgcctccatcctggtgctg
atggagatcattggcgacctgctgccgccgggcgtggtcaatgtggtcaacggctttggc
ctggaggccggcaagccgctggcctccagcaaccgcatcgcaaaaatagccttcaccggc
gagaccaccacgggccggctgatcatgcagtacgccagccagaacatcattcccgtgacg
ctggagctgggcggcaagagccccaacatcttctttgaggacgtgatgtccgccgacgac
ggcttcttcgacaaggcgctggaaggctttgcgatgttcgcgctgaaccagggcgaggtc
tgcacctgccccagccgcgcgttgatccaggaatcgatctacgagcgcttcatggagcgc
gcgctcaagcgcgtggccgccatccagcagggccacccgctggacaagaacaccatgatc
ggcgcccaggcctcgcaggagcaactggaaaagattctttcttacctggacctgggcaag
caggaaggcgcccagtgcctcatcggcggcgcgcgcaacaccgccctgggcggcgacctg
gccggcggctactacgtgcagcccacggtgttcaagggacacaacaagatgcgcatcttc
caggaagaaatcttcgggcccgtggtctcggtgaccaccttcaagaccgaagaagaggcg
ctggagatcgccaacgacacgctctacggcctgggcgcgggcgtgtggagccgtgatggc
gcgcgcgccttccgcatgggcaagggcatccaggccgggcgcgtgtggaccaactgctat
caccactaccccgcgcacgccgcgtttggcggctacaagcagtcgggcatcggtcgtgag
aaccacaagatgatgctggaccactaccagcagaccaagaacctgctggtgagctacacc
cagcagccgctgggcttcttctaa

DBGET integrated database retrieval system