KEGG   Diaphorobacter polyhydroxybutyrativorans: BA022_08205Help
Entry
BA022_08205       CDS       T04937                                 

Definition
(GenBank) hypothetical protein
  KO
K07058  membrane protein
Organism
dpy  Diaphorobacter polyhydroxybutyrativorans
Brite
KEGG Orthology (KO) [BR:dpy00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    BA022_08205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB RPA_C
Motif
Other DBs
NCBI-ProteinID: ASI68541
UniProt: A0A2Z2LH10
LinkDB All DBs
Position
complement(1783142..1784431)
Genome map
AA seq 429 aa AA seqDB search
MSLSLQSIAVRAEEWLVELSHFPWRTTAQTLRERFREDRLGLTASSLTFTTLLSLVPFVT
VALAMFTVFPMFAEMQLVLQRWLVDSLVPDSISRPVLGYLTQFAAKAHGLGAAGLSILMV
TALALILTIDRTLNNIWRVQRLRPLGQRVLIYWAALTLGPLVLAASLALTTSVASAASRG
IGDTLPGGARLLFDAIEFFVLAAGMAALYRYVPNTQVHWRHAWAGGVFVAVGIELAKKVL
SLYLASVPTYSVLYGTFATLPILLLWVYVAWVIVLLGAVVAAYLPSLLAGVARCATGEGW
AFLLAVEVLQQLHRARQQPPHGLSVLELAQRLRVDVLQVGSVLPVLAALDWVVRVDETAA
DGSDAADARYVLLAEPATTHMEPLVQRLLLARTPPLERLWAHTGLEVLTLADVLPRESVQ
RPSEMLLKR
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttgtccctacagtccattgcagtgcgtgccgaggagtggctggtggagctttcc
cacttcccctggcgcaccaccgcgcagacgctgcgcgagcgctttcgcgaggaccgcctg
gggctgacggccagcagcctcaccttcaccacgctgctgtcgctggtgccgttcgtgacg
gtggcgctggccatgttcaccgtgttccccatgtttgccgagatgcagctcgtgctgcag
cgctggctggtggacagcctggtgcccgacagcatctcgcgcccggtgctgggctacctc
acgcagttcgccgccaaggcgcatggcctgggcgcggcgggcttgtccatcctcatggtg
accgcgctggcgctgatcctcaccatcgatcgcacgctcaacaacatctggcgcgtgcag
cgcctgcgcccgctgggccagcgtgtgctgatctactgggccgcgctcacgctcggtccg
ctggtgctggcggccagcctggcgttgaccacctcggtcgccagcgccgcgtcgcgcggt
atcggcgacacgctaccgggcggagcgcgcctgctgttcgatgcgatcgagttcttcgtg
ctggccgccggcatggcggcgctgtaccgctatgtgcccaacacccaggtgcactggcgc
cacgcctgggcgggcggggtgttcgtcgccgtgggcatcgagctggccaagaaagtgctg
tcgctgtacctggcgtcggtacccacctattcggtgctgtacggcacgttcgccacgctg
cccatcttgctgctgtgggtgtacgtggcctgggtcatcgtgctgctgggtgcggtggtg
gccgcctatctaccgagcctgctcgccggcgtggcgcgctgcgccacgggcgagggctgg
gccttcttgctggccgtggaggtgctgcagcagctgcaccgcgcgcgccagcaaccgccc
cacgggctgagcgtgctggagctggcccagcggctgcgcgtggatgtgctgcaggtgggg
tccgtgctgccggtgctggcggcgctggattgggtggtgcgggtggacgagacggccgcc
gacgggtccgacgcagccgacgcacgctacgtgctgctggccgagccggccaccacgcac
atggagccgctggtgcaacgcctgctgctggcgcgcaccccgccgctggagcgcctgtgg
gcgcacacggggctggaggtgctcacgctggccgacgtgctgccgcgcgagtccgtgcag
cggccatctgagatgctccttaaacgatag

DBGET integrated database retrieval system