KEGG   Diaphorobacter polyhydroxybutyrativorans: BA022_13000Help
Entry
BA022_13000       CDS       T04937                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
dpy  Diaphorobacter polyhydroxybutyrativorans
Pathway
dpy00564  Glycerophospholipid metabolism
dpy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dpy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BA022_13000
Enzymes [BR:dpy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BA022_13000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 NAD_binding_8 Thi4 Lycopene_cycl Pyr_redox_2 HI0933_like GIDA 3HCDH_N Pyr_redox_3 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ASI69370
UniProt: A0A2Z2LJQ4
LinkDB All DBs
Position
complement(2847100..2848698)
Genome map
AA seq 532 aa AA seqDB search
MTSDTSTPLATVRADLLARLAQPVTYDLAVVGGGATGLGVALDAAARGFSVVLLESHDFA
KGTSSRATKLVHGGVRYLAQGNIALVREALHERTTLLRNAPHLAQPLAFVMPSYKVWETP
FYGVGLKMYDALAGKAGLGPTEFLGRMETLRCLPTAMADGLKGGVKYWDGQFDDARLALA
LARTAAQRGALLLNYCPVDDLLYDGGKVAGVVCQDAETGQRYEVRARCVVNATGVWVDAL
RQRDGDVSGQPAKPMVAPSQGVHIVVDREFLPSDHALMVPKTADGRVLFAVPWLGKVILG
TTDSPRQDLAREPQAMREEVAFILGESARYLRRAPQASDVRSIWVGLRPLVKPSDEDAAA
TKSISREHTVLASRSGLVTVTGGKWTTYRAMAEDVLLKCMDEHLLPRRPGGITVALPLVG
AGATRERQGMNAPQGLHSYGDEAARVQALPGSQVQLAEGLSEAMVRFAARHEYARTVEDV
LARRSRVLFLDARLAAALAPRVADILREEIPGKDPQLPAFLELAAHYATVPA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgactagcgacacctccacccctttggcaaccgtacgggccgacctgctggcccgcctg
gctcaacccgtgacctacgacctggcggtcgtcggaggtggggcgacgggcctgggggtg
gcgctcgatgcggcggcgcgcggcttttccgtcgtgctgctggaatcgcacgacttcgcc
aagggcacctcctcgcgtgccaccaagctggtacacggcggcgtgcgctacctcgcgcag
ggcaacatcgccctggtgcgcgaggcgctgcacgagcgcaccacgctgttgcgcaacgcc
ccccatctggcgcagccgttggcattcgtcatgccttcttacaaggtgtgggaaacgccg
ttctacggtgtgggactgaagatgtacgacgccctggctggcaaggcgggcctggggcct
accgaattccttgggcgcatggagaccctgcgctgcctgcccacggccatggccgacggg
ctcaagggcggcgtgaagtattgggacgggcagttcgacgacgcccgactggccctggcc
ctggcgcgtaccgccgcgcagcggggggctctgcttctcaactactgccccgtggacgac
ctgttgtacgacggggggaaggtggcgggcgtggtttgccaggatgccgaaaccgggcag
cgctacgaggtgcgtgcgcgctgcgtggtcaacgccaccggcgtgtgggtggatgccctg
cgtcagcgcgacggtgatgtgagcggccagcccgccaagcccatggtggcgcccagccag
ggggtgcacatcgtggtggaccgcgagttcttgccctccgaccatgcgctgatggtgccc
aagacggccgacgggcgggtgctgtttgcggtgccctggctgggcaaggtgattttgggc
acgaccgacagcccacgccaggatctggcacgcgagccccaggccatgcgggaggaagtg
gccttcatcctgggggaatcggcgcgctacctgcggcgcgccccccaggcgagcgatgtg
cgcagcatctgggtgggcctgcgtcccttggtcaagccctcggacgaagacgccgccgcc
accaagagcatcagccgggaacacaccgtgctggccagccgcagcgggctggtcaccgtg
actggcggcaagtggaccacctaccgcgccatggccgaggatgtactgctcaagtgcatg
gacgaacacctgctgccgcgccgcccgggcgggatcaccgttgcgctgcccctggtagga
gccggtgccacccgggagcgacagggaatgaacgcgccccagggtctgcattcctacggt
gacgaggccgcacgggtgcaagcccttccgggttcgcaggtgcaactggccgaagggctc
agcgaggccatggtgcgctttgccgcgcgccatgagtacgcacgcaccgtggaggacgtg
ctcgcacggcgctcgcgcgtgctgtttctcgatgcgcgcctggcggccgcgctggcgccg
cgcgtggcggacatcctgcgcgaggaaatccccggcaaggacccgcagctgcccgcgttc
ctggagttggccgcacactacgccacggtgccggcataa

DBGET integrated database retrieval system