KEGG   Diaphorobacter polyhydroxybutyrativorans: BA022_13950Help
Entry
BA022_13950       CDS       T04937                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
dpy  Diaphorobacter polyhydroxybutyrativorans
Pathway
dpy00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:dpy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BA022_13950
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dpy02000]
    BA022_13950
Enzymes [BR:dpy01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BA022_13950
Transporters [BR:dpy02000]
 Other Transporters
  Pores ion channels [TC:1]
   BA022_13950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_C_2 Arabino_trans_C
Motif
Other DBs
NCBI-ProteinID: ASI69544
UniProt: A0A2Z2LR76
LinkDB All DBs
Position
3030940..3031554
Genome map
AA seq 204 aa AA seqDB search
MTSLTLYFTPGTCAQAVRIALEEAQAPYTLVRVDFASQQQRSPEYLAVNPKGRVPALVTE
HGTLTETPALLAYVAQRFADARLAPADPFGFARLQEFHSYLASTVHIAHAHRPRASRWAD
EPEAQAAMQRKVPANMTECFTLIERHYLGDGPWVLGEQYSVADGYLFTVAGWLKSDGVDI
AQFPKVHAHSQRMAQRPAVQRALA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgacctctctcaccctctacttcacccccggtacctgcgcacaggccgtgcgcatcgcg
ctggaggaagcgcaagcaccctataccctggtccgcgtggacttcgccagccagcagcag
cgctcgcccgaataccttgcggtcaatcccaagggccgcgtgcccgcgctggtgaccgag
cacggaacgctcaccgagacccccgccctgctggcctacgtggcgcagcgcttcgcggat
gcgcgcctggcgcccgcagaccccttcggcttcgcgcgcctgcaggaattccacagctac
ctggcctccaccgtgcacatcgcccacgcccaccgcccgcgcgccagccgctgggccgac
gagcccgaggcccaggccgccatgcagcgcaaggtgcccgccaacatgaccgagtgcttc
acgctgatcgagcgccattacctgggcgacggcccgtgggtgctgggcgagcagtactcg
gtggccgacggctacctcttcaccgttgcgggctggctcaagagcgacggcgtggacatc
gcgcagtttcccaaggtgcacgcgcactcccagcgcatggcgcagcgccccgcggtgcag
cgcgccctggcctga

DBGET integrated database retrieval system