KEGG   Diaphorobacter polyhydroxybutyrativorans: BA022_14695Help
Entry
BA022_14695       CDS       T04937                                 

Definition
(GenBank) glutathione transferase GstA
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
dpy  Diaphorobacter polyhydroxybutyrativorans
Pathway
dpy00480  Glutathione metabolism
dpy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BA022_14695
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dpy02000]
    BA022_14695
Enzymes [BR:dpy01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BA022_14695
Transporters [BR:dpy02000]
 Other Transporters
  Pores ion channels [TC:1]
   BA022_14695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N_3 GST_C_2 GST_N_2 GST_C_3 GST_N GST_C_6
Motif
Other DBs
NCBI-ProteinID: ASI69681
UniProt: A0A2Z2LKM8
LinkDB All DBs
Position
3197224..3197832
Genome map
AA seq 202 aa AA seqDB search
MKLYYSPGACSLSPHIVLHETGLAHTSVLASTKSHKLQDGTDYYTINPLGYVPVLELDDG
TRLREGPAIVQYLADQAPHKNLAPANGTLARYRLQEWLTFIGTEIHKGFTPLFKPTTPAD
YKPLVHEQLLSRLKWVDGELAHKPYLMGEHFSVADAYLFTVTNWAPAVNLDISALKNLAA
YRERIAARPAVQAAMKAEGLLK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctactactcccctggcgcctgctcgctctccccgcacatcgtgctgcacgaa
accggcctggcccacacctcggtgctggccagcaccaagagccacaagctgcaggacggc
accgactactacaccatcaaccccctgggctacgtgccggtactggagctggacgacggc
acgcgcctgcgcgaaggccccgccatcgtgcagtacctggccgaccaggcgccgcacaag
aacctcgcccccgccaacggcacgctggcgcgctaccgcctgcaggagtggctgaccttc
atcggcaccgagatccacaagggcttcacccccctgttcaagcccaccacccccgcagac
tacaagcccctggtgcatgagcaactgctcagccgcctcaagtgggtggacggcgaattg
gcccacaagccctacctcatgggcgagcacttcagcgtggccgacgcctacttgttcacg
gtgaccaactgggcccccgccgtgaacctggacatctccgcactgaagaacctggcggcc
taccgcgaacgcatcgccgcccgccccgccgtgcaggccgccatgaaggccgagggcctg
ctcaagtaa

DBGET integrated database retrieval system