KEGG   Diaphorobacter polyhydroxybutyrativorans: BA022_16125Help
Entry
BA022_16125       CDS       T04937                                 

Definition
(GenBank) aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
dpy  Diaphorobacter polyhydroxybutyrativorans
Pathway
dpy00030  Pentose phosphate pathway
dpy01100  Metabolic pathways
dpy01120  Microbial metabolism in diverse environments
dpy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dpy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BA022_16125
Enzymes [BR:dpy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     BA022_16125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ASI69943
UniProt: A0A2Z2LLE3
LinkDB All DBs
Position
complement(3512825..3514672)
Genome map
AA seq 615 aa AA seqDB search
MSWAGKILRVNLSAGTVTPEPLNMDWARQYLGSRGLGTKYLVSEIDPQVDPLSPDNKIIW
ATGPLTGTMASTGGRYTVITKGPLTGAIACSNSGGYWGAELKMAGWDMVIFEGKSPKPVY
LYINDDVAELRDAADLWGKSVWETEEHLKTTLQDPLTRISGIGRAGENQVLFAAVVNDLH
RAAGRSGVGAVMGSKNLKAIAVRGTKGVGNIRDPKAFMAETFARKKILHDNAVTGQGLPT
YGTQVLMNVINEVGALPTRNHRDVQFEGAKDISAEAMATPRASDGKKHLVTNQACFGCTI
ACGRISKIDETHFTVVNKPQYWGASGGLEYEAAWALGAANGVNDLECLQYVNLLCNEQGI
DPISFGATVGAVMELYEMGVLTREQIGIEAPFGSAKALAFLAEETIHGRGFGKEVGQGSK
RLCTKYGHPDLSMSSKGQEFPAYDGRAIQGIGLAYATSNRGGCHLRGYTIASEILGIPVK
TEPTATEGKPELVKAFQDATAAFDSAGVCIFTTFAWSLPDLAPQLQAACDEGFTVPELEK
IGERIWNMEREFNNAAGFTKADDSLPRRLLTEAAKTGGSKGTVSHLPEMLPKYYAVRGWD
PEGRPTPETRARLGL
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgtcctgggctggcaagattctgcgcgtcaacctgagcgcgggcaccgttacccccgag
ccgctgaacatggactgggcacgccagtacctgggttcgcgcggcctgggcaccaagtac
ctggtcagcgagatcgacccccaggtcgacccgctgtcgccggacaacaagatcatctgg
gccacgggtccgctcacgggcaccatggcctccacgggcgggcgctacaccgtcatcacc
aaggggccgctcaccggcgccatcgcctgctccaactcgggcggctactggggtgccgag
ctgaagatggccggctgggacatggtcatcttcgaaggcaagtcccccaagcccgtgtac
ctgtacatcaacgacgacgtggccgagctgcgcgacgccgccgacctctggggcaagagc
gtgtgggagaccgaggagcacctcaagaccacgctgcaggacccgctcacgcgcatctcc
ggcatcggccgcgcgggcgagaaccaggtactgttcgccgccgtggtcaatgacctgcac
cgcgccgcgggccgctcgggcgtgggcgcggtcatgggcagcaagaacctcaaggccatc
gccgtgcgcggcaccaagggcgtgggcaacatccgcgatcccaaggccttcatggccgag
accttcgcgcgcaagaagatcctgcacgacaacgccgtcaccggccagggcctgcccacc
tacggcacgcaggtgctgatgaacgtgatcaacgaggtgggcgccctgcccacgcgcaac
caccgcgacgtgcagttcgaaggcgccaaggacatctccgccgaggccatggccacgccg
cgcgccagcgacggcaagaagcacctggtgaccaaccaggcgtgctttggctgcaccatc
gcctgcgggcgcatcagcaagatcgacgagacgcacttcaccgtggtcaacaagccgcag
tactggggcgccagcggcggcctggaatacgaggccgcctgggccctgggtgcggccaac
ggcgtgaacgacctggaatgcctgcagtacgtgaacctgctgtgcaacgagcaagggatc
gaccccatcagcttcggcgccaccgtgggcgcggtgatggagctgtacgaaatgggcgtg
ctcacccgcgagcagatcggcattgaggcgcccttcggctcggccaaggcgctggccttc
ctggccgaagaaaccatccacggccgcggctttggcaaggaggtgggccagggctccaag
cgcctgtgcaccaagtacggccatcctgatttgtccatgtcctccaagggccaggagttc
cccgcctacgacggccgcgccatccagggcatcggcctggcctacgccaccagcaaccgc
ggcggctgccacctgcgcggctacaccatcgcgtccgagatcctgggcatccccgtcaag
accgagcctacggccaccgagggcaagcccgagctggtcaaggctttccaggatgcgacg
gcggcgtttgactcggccggcgtgtgcatcttcaccaccttcgcctggagcctgcccgac
ctcgcccctcaactgcaggcggcgtgcgacgaaggcttcacggtgccggagctggagaag
atcggcgagcgcatctggaacatggagcgcgagttcaacaacgccgccggcttcaccaag
gccgacgacagcctgccccggcgcctgctgaccgaggcggccaagaccggcggctccaag
ggcacggtgagccacctgcccgaaatgctgcccaagtattacgccgtgcgcggctgggac
cccgaaggccggcccacacccgagacgcgcgcgcgcctgggactgtga

DBGET integrated database retrieval system