KEGG   Dinoponera quadriceps: 106743306Help
Entry
106743306         CDS       T05610                                 

Definition
(RefSeq) fanconi-associated nuclease 1-like isoform X1
  KO
K15363  fanconi-associated nuclease 1 [EC:3.1.21.- 3.1.4.1]
Organism
dqu  Dinoponera quadriceps
Pathway
dqu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:dqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    106743306
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dqu03400]
    106743306
Enzymes [BR:dqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.1  phosphodiesterase I
     106743306
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.-  
     106743306
DNA repair and recombination proteins [BR:dqu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     106743306
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VRR_NUC
Motif
Other DBs
NCBI-GeneID: 106743306
NCBI-ProteinID: XP_014472502
LinkDB All DBs
Position
Unknown
AA seq 890 aa AA seqDB search
MTQTRIDQFYKVASKKSGNTKNNVGRTSASHRFGINGRKGEISLGNLEAASVCKKKAGAS
RGSWRKRIARRSNISISTGTFYSSKVNMVHSPIKTIEAKTASSLSTNTPTVKQISPTSSP
MKSPVSSRSSNFTPKFTPKTPSPIKEALESPRSLKMARRKLFSDRIEELMPIVIDNLNQA
KERAIANNDINLEKVYSSGEFNYKYNRIDTTTSTRYEINDIIMPTDTYSRHFFSIIASVF
SKPFNCGYFNEYELDLIFSLLTISKNAQALMIRMLKRKHIWHRTDNIKYDNISTNLSPVF
DELVSRSIFKSNAKEEDMTVLLKLLQVEEIRKLCQEYKVCASGRHKKEHYVQSILKFHHN
SKPLFPGMPNPVTKLRASVNKILGCCVLIDTNVSKVIDKIITLLVPNQDPQQTMADLFNT
LVRVEMKEIKYPEVMVSDFPIFANKEHLSKYMEAKSALCQVLYAIEKKQWDVVRQIGSQA
EERLSLLLGRETQSLQNSKLPRHIRHFMPCYMWLKVLSKSIDAFKKSKETLSKAIKYLRI
LVKQKCHMKHKKGQWYNELIKIQVYHMKDPDGSVKLLSKAVEQESLTEVDRLDLLERAEN
LAKRKSNIDQHSKDTVKQILGKDLDKARLKYTPSSITIQGTLCRNLSQRKSTWCINEGID
KEYGTVESLALYDYKKKGYVKGVHCEGAFPVTLLGTLFWDEIYNLDIPGACVSPYEPTPL
DLFTSEFYENRREHIDKKLQAIRKFDVETLGNHLKQKFDLLCEYTSICQGNIFDSGISFQ
EVALCLGVEGVVGICERLIHNYTLWRAGFPDLIVWNPRTKQYKIVEVKGPGDSLSTKQKL
WLQYLNYLGLNTEVCYCEVSDIYKRAQRAIIICRILHALPFFKVPRLLSR
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atgacacaaacccgaatagatcaattctataaagtagcgagtaagaaatctggaaataca
aaaaataatgtaggaaggacatctgcttcgcacagattcggaattaatggaagaaaagga
gaaatatcattgggaaatttggaagctgcttctgtatgtaaaaaaaaggcgggtgcatcg
agaggaagttggaggaaacgcatagcgcgaagaagtaatatctcgataagcactgggacg
ttttattcttcgaaagtcaacatggtgcacagtccaatcaaaactatagaagctaagaca
gcatcatcactatctaccaacacaccaactgtcaaacagatttcccctacttcgagtccc
atgaaaagtcctgtgtcgtcgaggagctcaaattttactccgaaatttactccgaaaacc
ccgtctccgataaaggaagcactggagtctccgagaagccttaagatggcgcgaaggaaa
ttgttcagtgacaggatagaagaattaatgcccatagtgatagacaatcttaaccaggcg
aaagaaagagctattgcaaacaatgacatcaatctggagaaggtttattcgagtggagaa
ttcaattacaagtacaatcgtatagacacgacaacttcgacgagatacgaaatcaacgat
ataataatgccgaccgatacgtattcgcgacattttttctccattatcgccagcgtcttc
tccaaaccgttcaactgcggatacttcaacgagtatgagttagacttaatattttcgctg
ctgacaatttctaagaacgcacaggccctgatgatacgcatgctgaagagaaagcacatt
tggcacagaacagacaatatcaaatacgacaacatatccaccaacttgagtcctgtcttc
gacgagctcgtgtcgcgatctatttttaaaagtaacgcgaaggaagaagatatgaccgtt
ctgttgaagctgttgcaagtcgaagagattcgtaagctttgtcaggaatataaggtctgt
gccagcggccgtcacaagaaagagcactacgtacaatcgattctaaaattccaccataat
agcaaacccttgtttcccgggatgccaaatccggtcactaaattgcgtgcttcggtgaat
aaaattctaggatgctgcgtactgatcgacaccaacgtgagtaaagtaattgataaaata
attacgctgctggtgcctaatcaagatccccagcagaccatggcggatttattcaatacg
ttggtgagagttgaaatgaaggaaatcaaatacccagaagtaatggttagcgactttccc
attttcgccaataaagaacacctgtcgaaatatatggaggctaagagcgcgctctgtcaa
gtattgtatgcaatcgagaagaaacaatgggatgtcgtacgacaaatcggatcgcaagcc
gaggaacgtctatcacttctcttaggaagagaaacccaaagtctgcaaaactccaaatta
cctcgtcacatcaggcactttatgccgtgctacatgtggctcaaagttctgtccaagagt
atcgacgcgtttaagaagagcaaagaaacactgtcgaaagcgatcaagtatttgcgcata
ctagtcaagcagaagtgtcacatgaaacacaagaaagggcagtggtacaatgaattaata
aaaatacaagtatatcatatgaaggatcccgacggtagcgtcaagctcctctcgaaagct
gtggaacaggaaagtttaacggaagtcgacaggttggatctgttggagagggcggagaat
ctcgcaaaaagaaaatccaacatcgatcagcattcgaaggacacggttaaacagatattg
ggcaaggacctcgacaaagcgcgactaaaatacacaccgagttctattacaatacaagga
actttgtgcaggaacctctcgcaaaggaagagcacctggtgcatcaacgaggggatcgac
aaagagtacggtacggtcgaaagtctagcgttgtacgactacaagaagaagggttacgtc
aaaggtgtccactgcgagggtgcttttccagttacccttttgggtacgttattctgggac
gagatctacaacctggacattcccggcgcttgcgtatcgccgtacgagcccacaccgttg
gatctattcacgtcggaattttacgaaaatagaagagaacacatcgacaagaagctccaa
gctattcggaaattcgacgtagaaacgttgggcaatcatctgaagcagaaattcgactta
ctgtgtgaatatacttccatctgtcaggggaatatctttgacagcggtatcagcttccag
gaggtggcgctttgtttgggagtagaaggtgtagttgggatctgcgaacgactcattcat
aactatacactctggagagctggcttcccagatttaatcgtatggaatccacgtacaaaa
cagtacaaaattgtagaagtgaagggccccggtgactcactctcgaccaaacaaaagtta
tggttgcaatacttgaattacctcggactgaatacggaagtgtgttattgcgaagtaagc
gatatttataaaagagctcagcgtgctattataatatgtcgaatattacatgctctgcca
ttcttcaaggtgccaaggcttctgtcacggtga

DBGET integrated database retrieval system