KEGG   Dinoponera quadriceps: 106743902Help
Entry
106743902         CDS       T05610                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dqu  Dinoponera quadriceps
Pathway
dqu00010  Glycolysis / Gluconeogenesis
dqu00030  Pentose phosphate pathway
dqu00051  Fructose and mannose metabolism
dqu00052  Galactose metabolism
dqu01100  Metabolic pathways
dqu01200  Carbon metabolism
dqu01230  Biosynthesis of amino acids
dqu03018  RNA degradation
Module
dqu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106743902
   00030 Pentose phosphate pathway
    106743902
   00051 Fructose and mannose metabolism
    106743902
   00052 Galactose metabolism
    106743902
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    106743902
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dqu01009]
    106743902
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dqu03019]
    106743902
Enzymes [BR:dqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     106743902
Protein phosphatases and associated proteins [BR:dqu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106743902
Messenger RNA biogenesis [BR:dqu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     106743902
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK Herpes_UL51
Motif
Other DBs
NCBI-GeneID: 106743902
NCBI-ProteinID: XP_014473676
LinkDB All DBs
Position
Unknown
AA seq 855 aa AA seqDB search
MFEKSKFESGEHSPTGSSFKIEFDALEEEYVARLHFPHAVTQTNYKRYCRKMAEEPVQRF
IKPGSHKGKGLAVFTSGGDSQGMNAAVRAVVRMGIYLGCKVFFIREGYQGMVDGGTYIEE
ATWSSVSCIIHRGGTVIGSARSQDFRERVGRRKAAKNLVIRGITNLVVIGGDGSLTGANL
FKEEWPELLKELVDGGDITAEQSEKHKHLHIVGMVGSIDNDFCGTDMTIGTDSALHRIIE
SIDAIVSTAYSHQRTFIMEVMGRHCGYLAIVGALAAEADYVFFPECPPPVDWPEKLCKKL
EQERLTGQRLNIIIVAEGAVDRNGDPITAEKVHKVVVEKLQQDTRITVLGHVQRGGNPSA
FDRVLGCRMGAEAVMALMEATPETEACVVTLDGNQAVRLPLMECVRRTKAVAQAMADKNW
DLAVQLRGKGFERNLETYKMLTRLKAPVESSDPTKEVNGRALPKQYTLCGQDHYTLAVMH
IGSPSCGMNAAVRSFVRNCIYRGDKVYGICDGVMGLIDGRLKLMDWPSVTGWVAQGGAYL
GTKRAPPKEDQLPQIAQKLKEFGIQALLIIGGFEGYQTGLTFFKARDKYKEFRIPIAMIP
ATISNNVPGTEFSLGCDTALNEITEICDRIRQSAQGTKRRVFIIETMGGFCGYLATVAGL
AGGADAAYIFEEKFNIKDLNQDVIAMAAKMSEGVQRGLILRNENANQNYNTDFMQRLFSE
EGKGLFSCRMNIIGHMQQGGSPTPFDRNLGTKMGAKAVEWFSDQLRKCTTPDGKTVTIEA
DSAVMLGIVRRQYRYTPFMELREVTDFDHRIPTYQWWMKLRPLLKVLAKHESTYEEEGLY
ITVEEMDLQNDPPLV
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagaagagcaagttcgaatcaggagaacactcgcctaccggctcctcgtttaag
atagaatttgacgcgctggaggaggaatatgtcgcacgcctgcactttccacacgctgtc
acacagacaaactacaagagatactgtagaaagatggctgaagaaccggttcaaagattt
ataaaacctggcagccacaaaggcaaaggtcttgctgtgttcaccagcggaggcgactct
caaggaatgaatgctgccgtacgagcggtcgttaggatgggcatctatctcggatgcaaa
gtgttcttcatcagagagggttatcaaggaatggttgacggtgggacgtacatagaggaa
gcgacgtggtcgtccgtgtcttgcatcatccacagaggtggcacagtgatcggctctgca
cggtcacaggatttcagggagcgtgttggtcgccggaaggctgcgaaaaacttggtgatc
cgcggaataaccaatctggtggtgataggcggagacggctctctcactggcgccaatctc
ttcaaggaagagtggcctgaactactgaaagagctcgtcgatgggggcgacatcaccgcc
gagcaaagcgagaagcacaagcacttgcacatcgtgggaatggtgggttccatcgataac
gatttctgcggcacagacatgacgatcggcaccgactcggcgttgcatcgcatcatcgaa
agtatagacgctatcgtcagcacggcttactctcaccagagaacatttataatggaagta
atgggtcggcattgcgggtatctggctatcgtgggcgctctagctgcggaggccgactat
gttttcttcccggaatgtccgcctcccgtcgactggcccgaaaaattatgtaaaaaattg
gagcaggagcggcttaccgggcaacgactcaacatcattatcgtggctgaaggagctgtt
gacaggaatggcgatccgattaccgccgagaaggtgcacaaagtagtcgtggagaagctg
cagcaagataccaggatcactgtcctgggtcacgtacaaagaggtggtaatccctcagcc
ttcgatcgagttttgggatgccgaatgggagctgaagctgtgatggctctgatggaggcg
acacccgagaccgaggcgtgcgttgtcacactggacggtaatcaagctgtgagattacca
cttatggaatgcgtgcgccgtacgaaggccgtagcgcaggctatggccgacaaaaattgg
gatcttgcggttcagctgcgaggaaaaggcttcgaacgtaatctggagacttacaagatg
ctgacgcgccttaaagctccggtggaaagttccgatccaaccaaggaagttaatgggcgt
gcattaccgaagcaatacactttgtgcggacaagatcattacacgctggcggttatgcac
ataggatcaccgtcctgcggcatgaacgccgcagtccgctccttcgtgaggaattgtatc
tatcgaggcgataaggtgtacggtatctgtgacggagtgatgggcctcatagacggcaga
ttgaagctgatggattggccttcggtcaccggctgggttgcgcaaggcggcgcttatctg
gggacgaaacgcgcgccacccaaggaagaccaactcccgcaaatcgctcagaaactcaag
gaattcgggattcaagcactactaatcataggtggattcgagggttatcaaactggcctg
acgttcttcaaagcaagggacaagtacaaggaattccgtattcctatcgccatgatccct
gcgactatcagcaacaatgtgccaggaacggaattttctcttggttgtgacacagctttg
aatgagattacagaaatttgtgaccgtattcgacaatcggcgcaaggtactaagcgtcgt
gtattcatcatcgaaacgatgggtggcttttgcggatatttagcgacagtcgctggtctg
gctggaggtgctgatgcggcatatatcttcgaggaaaagtttaatatcaaagacctgaat
caagatgtcattgcgatggcggcgaagatgtcggaaggcgttcagcggggtctcatactt
aggaacgagaacgccaatcaaaattataataccgattttatgcagagacttttcagtgag
gaggggaagggtttatttagctgcaggatgaacataattggtcacatgcaacaaggtggc
tcgccgacgcccttcgatcgcaatttgggaacaaagatgggcgctaaggccgtggaatgg
ttcagcgaccaattgcgaaagtgcaccactcccgatggcaagacagtcaccatcgaagcg
gacagcgctgtgatgctcggtatcgtaagacgacaatacagatatacaccgttcatggaa
ctccgcgaagttaccgactttgaccatcgcattccgacatatcaatggtggatgaagctg
cgtccgttgctgaaggtgttggcgaaacacgaatcgacatacgaagaggagggcctgtat
ataacagtcgaggagatggatcttcagaacgacccacctctcgtataa

DBGET integrated database retrieval system